KEGG   Shewanella japonica: SJ2017_1481Help
Entry
SJ2017_1481       CDS       T04959                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sja  Shewanella japonica
Pathway
sja00071  Fatty acid degradation
sja00072  Synthesis and degradation of ketone bodies
sja00280  Valine, leucine and isoleucine degradation
sja00310  Lysine degradation
sja00362  Benzoate degradation
sja00380  Tryptophan metabolism
sja00620  Pyruvate metabolism
sja00630  Glyoxylate and dicarboxylate metabolism
sja00640  Propanoate metabolism
sja00650  Butanoate metabolism
sja00900  Terpenoid backbone biosynthesis
sja01100  Metabolic pathways
sja01110  Biosynthesis of secondary metabolites
sja01120  Microbial metabolism in diverse environments
sja01130  Biosynthesis of antibiotics
sja01200  Carbon metabolism
sja01212  Fatty acid metabolism
sja02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SJ2017_1481
   00630 Glyoxylate and dicarboxylate metabolism
    SJ2017_1481
   00640 Propanoate metabolism
    SJ2017_1481
   00650 Butanoate metabolism
    SJ2017_1481
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SJ2017_1481
   00072 Synthesis and degradation of ketone bodies
    SJ2017_1481
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SJ2017_1481
   00310 Lysine degradation
    SJ2017_1481
   00380 Tryptophan metabolism
    SJ2017_1481
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SJ2017_1481
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SJ2017_1481
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SJ2017_1481
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sja04147]
    SJ2017_1481
Enzymes [BR:sja01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SJ2017_1481
Exosome [BR:sja04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SJ2017_1481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ARD21800
Position
1761010..1762203
Genome map
AA seq 397 aa AA seqDB search
MSTTHSSPQDIVIVAAKRTPMGGFQGALSAVTSPTLAANAIKGLVSHTQIDTHLIDEVLM
GCVLPAGLGQAPARQATLGAELPLSVGATTINKVCGSGMKTVMMAHDLIKAGSAEVVVAG
GMESMTQAPYLLDKARSGMRMGHGKVLDHMFLDGLEDAYTGGAMGTFAQKTADDFGLTRE
NMDQFALNSLEKANAAIQSGAFKDEIVPVTISSRRGDVTVDTDEQPGNARPEKIPSLRPA
FAKDGTITAANSSSISDGAAALMLMSREKAESLGLTIMATIKGHTTHSQEPSMFTTAPVG
AMNKLFDKVNWSKADVDLFEINEAFGMVTMLAISELQLDESKVNINGGACALGHPIGCSG
ARVLVTLIHSLKAKGLSKGVASLCIGGGEATAMAIEV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccacacattcatcaccacaagatatcgttatcgttgctgctaagcgcacccca
atgggtggctttcaaggcgcattatcagcagtgacatctccaacattagccgccaatgcg
attaaagggttagtcagtcacactcagattgatactcatttaattgatgaagtcttaatg
ggttgtgtattgcctgcaggtttaggacaggcgccagctcgtcaagcgacattaggagct
gaattacctttaagtgttggtgcaacgaccatcaataaagtctgcggttcaggtatgaag
accgtgatgatggcgcacgacttaatcaaagcgggtagtgctgaagttgttgttgctggt
ggtatggaaagtatgacccaagcgccttatttattagataaggcgcgtagtggaatgcgt
atgggtcatggcaaagttttggaccatatgttcctcgatggccttgaagatgcttacact
ggcggtgcaatggggacttttgcccaaaaaactgctgatgattttggcttaactcgtgaa
aacatggaccaattcgcactgaactctttagaaaaggctaacgcagcgattcagtctgga
gcgtttaaagatgaaatcgtgccagtgacgatttcaagtcgtcgaggtgatgtcacagtg
gatacggatgagcagccaggcaatgcgcgtcctgaaaaaatcccttcactacgtccagca
tttgctaaagacggcacaattacagccgctaactcaagctctatttcagatggtgctgcg
gccttaatgttaatgagccgagaaaaagcggagtcattaggcctcactattatggcgaca
attaaaggccataccactcattctcaagaaccttcaatgtttaccactgcaccagtcggt
gcaatgaacaagctattcgataaagttaattggtctaaagctgatgtggatttattcgaa
attaacgaagcattcggcatggtgactatgttagctattagtgaattacaacttgacgaa
tctaaagtcaatatcaatggcggcgcttgcgcattaggccatcctattgggtgctctggg
gcacgtgtacttgtgacgttaattcattcgctaaaagccaagggcttatctaaaggtgtg
gcgtcattatgtattggtggtggtgaagcaacggcaatggcaattgaagtttaa

DBGET integrated database retrieval system