KEGG   Shewanella japonica: SJ2017_1780Help
Entry
SJ2017_1780       CDS       T04959                                 

Definition
(GenBank) Methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sja  Shewanella japonica
Pathway
sja00450  Selenocompound metabolism
sja00970  Aminoacyl-tRNA biosynthesis
sja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sja00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SJ2017_1780
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SJ2017_1780
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sja01007]
    SJ2017_1780
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sja03016]
    SJ2017_1780
Enzymes [BR:sja01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SJ2017_1780
Amino acid related enzymes [BR:sja01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SJ2017_1780
Transfer RNA biogenesis [BR:sja03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SJ2017_1780
 Prokaryotic type
   Other AARSs
    SJ2017_1780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 PhnA_Zn_Ribbon
Motif
Other DBs
NCBI-ProteinID: ARD22091
Position
complement(2127152..2129194)
Genome map
AA seq 680 aa AA seqDB search
MTNSQRKILVTSALPYANGPIHLGHMLEYIQTDIWSRYQKLRGHECHYICADDAHGTPIM
LKAQQMGITPEEMIAQVQKEHEQDFADFNIQFDNFHSTHSDENRELASDIYLKLRDGGYI
KTKTISQLYDPEKEMFLPDRFVKGTCPKCKSEDQYGDNCDNCGATYSTTDLINPYSVVSG
ATPVMKDSEHFFFDLPAFETMLGEWLSSGSLQPEIANKLREWFDQGLQQWDISRDAPYFG
FEIPEQPGKFFYVWLDAPIGYMGSFKNLCDKRDDLNFDEYWNKDSSTELYHFIGKDIVNF
HGLFWPAMLDGAGVRKPTSVFAHGYVTVNGAKMSKSKGTFIKARTYLDNLNPEYLRYYYA
AKLNSRVDDLDLNLEDFAQRVNSDLVGKLVNLASRTAGFISKRFEGKLAKINDMSLTEAF
LAKQDLIADLYETREFGKAMREIMALADMANAYVADAAPWQLIKDEAKQEEAHQVCSNAL
NLFRILVTYLKPVLPQLAEKVESFLQLTLTWDNLNQDLAGHEIAKFKALMQRIEMKSIEA
IIEASTENLQVAETKAPKAEQVQTELEKEPLAPEITFDDFAKVDLRIALIAKAEHIEKAN
KLLRLELDLGGETKQVFAGIKSAYAPEDLIGKHTVMVANLAPRKMKFGESEGMVLAAGPG
GKDIWILEPHAGAKPGMRVM
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgacaaattcacaacgtaaaatcctggtgacaagtgccctcccatatgccaatggtcct
atccatttaggtcatatgcttgagtatattcaaactgatatttggtctcgttaccaaaag
cttcgtggacatgaatgtcactatatttgtgctgatgatgcccatggcaccccaatcatg
ctcaaagctcaacaaatgggaattaccccagaagaaatgattgctcaagtacaaaaagag
catgaacaagatttcgcggactttaatattcaatttgataactttcacagtactcacagt
gatgagaaccgtgaattagccagtgatatttacttaaaattacgcgatggcggttacatc
aaaaccaaaaccatctcgcaattatatgatcctgaaaaagaaatgtttttaccggatcgt
ttcgttaaaggcacctgccctaaatgtaaaagtgaagatcaatacggtgataactgtgac
aactgcggtgcaacttacagcacaacagatttaatcaatccttactctgttgtatcaggt
gcaactccagtcatgaaagacagtgaacacttcttttttgacttaccagcatttgaaacc
atgctcggtgagtggctttcatcaggttctttacaacctgaaattgctaacaaattaaga
gaatggttcgaccaaggattacaacagtgggatatctcacgtgatgcgccgtattttggg
ttcgaaattccagagcaaccaggcaagtttttctatgtgtggctagatgccccaattggt
tacatgggttcattcaaaaacttatgtgataaacgtgatgatctgaactttgacgaatac
tggaataaagattcaagcaccgagctttatcactttatcggtaaagatatcgtaaacttc
cacggtttattctggcctgcaatgcttgatggcgcaggtgtgcgtaaacctacgagtgtt
tttgctcatggttacgtcacagtgaacggcgcaaagatgtctaaatcaaaaggcaccttc
atcaaagcccgtacctacttagataacttaaaccctgagtaccttcgttattactatgcc
gctaaattaaatagccgtgttgatgacttagatttaaaccttgaagacttcgctcaacgc
gtaaactcagatctagtcggtaaattggtaaacttagcatctcgcacggctggttttatc
agtaaacgatttgaaggtaagttagctaaaattaacgatatgtcgttaacagaggctttc
ttagctaaacaagatcttattgctgatttatatgaaacccgtgaattcggtaaagcgatg
cgtgaaatcatggcacttgccgatatggcgaacgcttatgttgccgatgctgcaccttgg
cagttaatcaaagacgaagcaaaacaagaagaagcgcatcaagtttgtagtaatgcactt
aacttgttccgtattttggtgacttacctaaaaccagtgttgcctcagttagctgaaaaa
gttgaaagcttcctacagttaaccttaacttgggacaatttaaaccaagatttagcaggc
cacgaaattgctaagtttaaagcgttaatgcaacgtattgaaatgaagagtattgaggcg
attattgaagcgtcaactgaaaatcttcaagttgcagaaaccaaagcccctaaagctgag
caagtgcaaacagaacttgaaaaagagccgttagcacctgaaatcacttttgatgatttt
gctaaggttgatttacgtattgcactcattgctaaagctgagcacattgaaaaagcgaat
aaactccttcgtttagagcttgatttaggcggtgaaactaaacaagtatttgctggcatt
aaatcggcttatgcgccagaagatttaattggtaaacacactgtcatggtcgctaacctt
gcgccgcgtaagatgaagtttggcgaatctgaaggcatggtgttagcagcaggccctggt
ggaaaagatatctggattttagaaccacacgctggcgctaaaccaggcatgcgagtgatg
tag

DBGET integrated database retrieval system