KEGG   Shewanella japonica: SJ2017_2867Help
Entry
SJ2017_2867       CDS       T04959                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
sja  Shewanella japonica
Pathway
sja00480  Glutathione metabolism
sja00590  Arachidonic acid metabolism
sja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sja00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    SJ2017_2867
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SJ2017_2867
Enzymes [BR:sja01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SJ2017_2867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA DUF4174
Motif
Other DBs
NCBI-ProteinID: ARD23146
Position
3391913..3392398
Genome map
AA seq 161 aa AA seqDB search
MSQSFYDQSAVDIQGNTVSMAQFKDKVVLVVNTASECGFTHQYKPLEHLYQLYKDQGFVV
LGFPCNQFGKQEKGDEAAISEFCEINFGVTFPLFSKIDVNGPDSAPLYTFLKSQAKGLLG
SQSIKWNFTKFLINKDGKVLNRYSPTTKPENLMSEIEGLLK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagtctttttacgatcaatcagcagttgatattcaaggtaataccgtttcaatg
gcacaatttaaagacaaagttgtgttagtcgttaacaccgctagtgaatgtggctttact
catcaatacaaaccactggagcatttataccaactctacaaagatcaaggttttgtggta
ttaggttttccgtgtaatcaatttggtaaacaagaaaaaggcgacgaagcagctatcagt
gaattttgtgaaattaatttcggggtcaccttcccactatttagcaaaattgatgtaaat
ggcccagattcagcaccgctatatactttcttgaagtcacaagctaagggattattaggt
agtcagtcgataaaatggaactttacaaagtttttaatcaacaaagatggcaaggttctc
aatcgatattcaccaacaacaaagccggaaaacctaatgagtgaaattgagggcttatta
aaataa

DBGET integrated database retrieval system