KEGG   Shewanella japonica: SJ2017_3879Help
Entry
SJ2017_3879       CDS       T04959                                 

Definition
(GenBank) Haloacetate dehalogenase H-2
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
sja  Shewanella japonica
Pathway
sja00361  Chlorocyclohexane and chlorobenzene degradation
sja00625  Chloroalkane and chloroalkene degradation
sja01100  Metabolic pathways
sja01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sja00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SJ2017_3879
   00361 Chlorocyclohexane and chlorobenzene degradation
    SJ2017_3879
Enzymes [BR:sja01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     SJ2017_3879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: ARD24111
Position
complement(4621282..4621983)
Genome map
AA seq 233 aa AA seqDB search
MKENLKRPNITLAFDVYGTLINTHGVLILLETMIGDKAKAFSNRWREKQLEYSFRRGLMK
NYVPFSDCTRQALEYTCDYYQISLSAEQKHALMECYKTLPSFEDVKPALITLKAQGYRMF
AFSNGTKRAVETLLHAAGIDALFEGVVSADEIKTFKPNPDIYQHFLQATESKESDTWLIS
SNPFDVIGAIATGLKAAWVKRTEGAVFDPWEMQPNVIVADLHLLDSALNECVE
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagaaaatctaaagcgaccaaacatcaccttggcttttgatgtgtatggcacctta
attaatactcatggcgtgttaatcctgctcgagacaatgataggcgacaaggctaaagcc
ttttccaatcgttggcgtgaaaagcaattagagtattcctttcgtcgcgggttgatgaaa
aactatgttccttttagtgactgtactcgccaagcacttgaatatacctgcgattattat
caaatttccttatctgctgaacaaaaacatgcgctgatggagtgttataaaaccttaccc
agctttgaagatgttaagcctgccttgataacattgaaagcccagggttatcgtatgttt
gctttttcaaatggcactaagcgtgccgttgaaacattactgcatgctgcgggaatagat
gcattgtttgaaggggtcgtcagcgctgacgagataaaaacgtttaagcctaacccagat
atttaccaacactttttacaggcaactgagtcaaaggaaagtgatacttggctgatatca
agtaatccgtttgatgtgattggtgcaatagcgacggggcttaaagcggcatgggttaag
cgaactgaaggcgctgtatttgatccgtgggaaatgcagcctaacgtgattgttgctgat
ttacatctgcttgattctgcacttaacgagtgtgttgaatag

DBGET integrated database retrieval system