KEGG   Salimicrobium jeotgali: AAV35_000675Help
Entry
AAV35_000675      CDS       T04359                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
sje  Salimicrobium jeotgali
Pathway
sje00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:sje00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AAV35_000675
Enzymes [BR:sje01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     AAV35_000675
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     AAV35_000675
    1.1.1.-  
     AAV35_000675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc 2-Hacid_dh_C AlaDh_PNT_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: AKG03438
UniProt: K2FI43
Position
126233..127282
Genome map
AA seq 349 aa AA seqDB search
MKAAVWYGKKDLRVEEREEKPLKDDEVKVRVGWAGICGSDLHEYEEGPVFVPNEEKDELT
GEQAPLTMGHEFAGVVEEVGANVKNVKKGDRVAINPTLTHGDKPEDVDIYDGFSFIGLHG
DGGFTKYANVPEENAYLLPESMTLQDGALVEPTAVAVQAIKEADMSFGDTVAVFGVGPIG
LATILAAKAAGATRIIALDLSEKRLQKAAEVGATDVINSGEKDPVEAVHELESDGVDTAF
EVAGVEPTFNQAISVTKARGTMVIVSIFSKAIEWNPMQLTGSGVKLTSTIAYSPSTFQRT
IDLMGTGQLNPRGIITDKIKLDDIVDKGFEALSNDKSQAKILVELSGEK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtatggtatggaaaaaaagacttgcgtgtagaagagcgggaagagaaa
cctcttaaagatgatgaagtgaaagtccgggtcggctgggcaggtatttgtggaagtgac
cttcatgaatatgaagaaggtcctgtcttcgtaccgaatgaagagaaagatgagcttaca
ggagaacaggcacctcttaccatgggccacgagtttgccggggtcgttgaggaagttggt
gcgaatgtaaagaatgttaaaaaaggggaccgtgtagcaataaatcctacgttgactcac
ggcgataaaccggaagacgtggatatctatgatgggttcagttttataggcctccacggt
gatggaggatttacgaagtatgccaacgttccggaagaaaatgcttatcttttaccggag
tccatgaccttgcaggatggcgcactcgtagaaccaaccgcagtagctgtacaggcaata
aaagaagcagatatgtcgttcggtgatacggttgctgtgtttggagtcggacctataggt
cttgctacgattctggctgcgaaggctgccggagctacaaggattattgctctggacctt
tctgaaaagcgtcttcagaaagcggcagaggtcggggcgacagacgttatcaattccgga
gagaaagatcccgtagaagcagttcatgaactggagtcggacggagtagacacagctttt
gaagtagccggagtagaacctaccttcaatcaggccataagcgtaacgaaggcaagagga
acaatggtgattgtgtctattttttctaaggctattgagtggaacccgatgcagttaact
ggaagtggtgtgaaactgacctcaactatcgcctattcgccgagcacattccagcgaact
attgatcttatgggaaccggacagttaaaccctcgcggaataattacggataagattaaa
ctcgatgatattgtagacaaaggattcgaagctttgagcaacgataaatctcaggcgaag
attcttgtagaattgagtggagaaaaataa

DBGET integrated database retrieval system