KEGG   Salimicrobium jeotgali: AAV35_001560Help
Entry
AAV35_001560      CDS       T04359                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
sje  Salimicrobium jeotgali
Pathway
sje00220  Arginine biosynthesis
sje01100  Metabolic pathways
sje01110  Biosynthesis of secondary metabolites
sje01130  Biosynthesis of antibiotics
sje01230  Biosynthesis of amino acids
Module
sje_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:sje00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    AAV35_001560
Enzymes [BR:sje01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     AAV35_001560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N Transketolase_C
Motif
Other DBs
NCBI-ProteinID: AKG03598
UniProt: K2GNY0
Position
303026..303973
Genome map
AA seq 315 aa AA seqDB search
MRTETTDPKEEISLKGKHLLTWKDYSRKEIIHLLERALVLKQSPYSGALSQKTLAMIFEK
SSTRTRVSFEVGMTQLGGTAINLNSRDMQLGRGETIGDTAKVLSRYVDGIMIRTDAHQKL
EELAGNGSVPVISGLCDLYHPCQALADMLTVYEQKGQLAGVKLVYTGDGNNVAHSLMTIG
AILGLEVVVASPSGYWPLDFITGNAKKLAAKHGGSVTVTENVEEAAAGADILYTDVWTSM
GQDGEEKERKEALFPYQINERLVTAAKPDVSVLHCLPAHREEEITKEVMEGEHSFVFEQA
ENRLHVQKAILEALL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgaggacggaaaccacggatccaaaggaagaaatttctttgaaagggaagcacctgctt
acctggaaagactacagcagaaaagaaatcattcatttacttgaaagagcgctggtattg
aaacagtctccctactctggtgcgttatctcaaaaaactctggctatgattttcgaaaaa
tcgtcgacccggacccgcgtctccttcgaagtggggatgacgcagctcggagggacagcc
atcaatctgaacagccgggacatgcagcttggacgcggagaaacaatcggggatacggcg
aaggttctgtcgcggtacgtggatggtattatgatccgcaccgatgcgcatcagaaactc
gaagagctggccgggaacgggagtgtccccgttatcagcggactttgtgatttgtaccat
ccgtgccaggcactggccgatatgctcactgtttatgagcagaaaggtcaattagccggg
gtgaaactcgtttataccggagatggaaataatgtagcccactctcttatgacgatagga
gcaattctcggtctcgaggtcgtggtagcctctccctccggctattggccgcttgatttt
ataacagggaatgcaaagaagctggcggcaaaacatgggggcagtgttacagtaacagaa
aacgtggaagaagctgccgcgggtgccgatatcctttataccgatgtctggaccagtatg
ggacaggacggagaagaaaaagaaagaaaagaggcgcttttcccctatcagattaatgaa
aggcttgtgacagcagcaaagccggacgtaagtgttcttcactgtctgccggcacaccgg
gaagaggagatcactaaagaggtgatggaaggggaacattcttttgtctttgaacaggcc
gaaaatcgccttcatgtacaaaaagcaattttggaagcattactttaa

DBGET integrated database retrieval system