KEGG   Salimicrobium jeotgali: AAV35_001570Help
Entry
AAV35_001570      CDS       T04359                                 

Definition
(GenBank) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
sje  Salimicrobium jeotgali
Pathway
sje00330  Arginine and proline metabolism
sje00360  Phenylalanine metabolism
sje00380  Tryptophan metabolism
sje00627  Aminobenzoate degradation
sje00643  Styrene degradation
sje01100  Metabolic pathways
sje01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sje00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    AAV35_001570
   00360 Phenylalanine metabolism
    AAV35_001570
   00380 Tryptophan metabolism
    AAV35_001570
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    AAV35_001570
   00643 Styrene degradation
    AAV35_001570
Enzymes [BR:sje01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     AAV35_001570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AKG03599
UniProt: K2FMH0
Position
305060..306457
Genome map
AA seq 465 aa AA seqDB search
MYIKELSEIDGIAQARMVKEGAVSQEEVLLHYRMIQEERNPELNAIVHEVKNADYRKDGF
FAGLPFLIKDLNAVKGAPLTYGSKVMEGFTAPGDEEIVRRYKKAGLNITGKTNTPEFGFT
PATESQFLGETINPWDRTRSPGGSSGGAAVAVAAGMVPFAHGSDGGGSLRIPASNTGTFG
FKPTRGRSPLTMYLNSLSVQHALTTSVRDSAALLDVIEGPVPGTGYGFPEKDLPFFDTIG
ESPGKLKIAYAPNVHGNIEIDEEVQEVVRDAAEKCASLGHEVEEVYPDFDHDGMMEAYIY
LWVVGGALSVDKAASANNKAPADPFIEKMLSTLKEKAAGYSALEYEKAREKVFLETQKLD
RFFEEYDVLINPVNHKKALPLGRYNGEEKTIDEILSVSEIYAYLTPIANMTGQPAMSVPT
YWTKENLPIGSHFQARYGRDKVLFQLARQLEEAFPWKEKYKEIRG
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgtacataaaagagctgagtgaaatagatggaatagcccaggcccgtatggtgaaagag
ggagcggtatcgcaagaagaggtgctgcttcattatcgcatgattcaggaggagagaaat
ccggagctgaatgcgatcgttcatgaagtgaagaatgccgattaccggaaggacggtttc
ttcgcagggctgccgttcctcatcaaagatttgaatgcggtcaaaggagcaccgttgact
tacggttccaaagtgatggaaggattcacggcacccggggatgaagagatcgtcaggcgc
tacaaaaaagcgggcctcaacattaccgggaaaacgaacactcccgagttcggattcact
cctgctacggaatcacagtttctcggggagacgatcaatccgtgggatcggacgagatct
ccgggcggatcaagcggaggtgctgcggtagctgtagctgcaggaatggtacctttcgct
cacgggagtgacggaggaggatcccttcgtatacctgcatcaaataccggcacgttcggt
tttaaaccgacacggggccgctctccgcttacgatgtatcttaacagcctttctgttcag
catgcgctgacgacttccgtacgggacagtgccgccctgcttgatgtcattgaagggccg
gtcccggggacgggttacggtttcccggagaaagatcttcctttttttgacaccatcggt
gagtctccggggaaactgaaaatagcttatgccccgaacgtacacggcaatatcgagatc
gacgaagaagtacaggaagtggtgcgggatgcggcagaaaagtgcgcttctctcggtcat
gaagtggaagaagtatatccggattttgaccacgacggtatgatggaagcttatatttac
ctgtgggtcgtcggaggagcgctcagtgtagataaagcagccagtgcgaacaataaggcc
ccggctgacccttttatcgaaaaaatgttatctacgctgaaggaaaaagctgccggctac
agtgctcttgaatatgagaaagccagggagaaagtttttctcgagacgcagaagctcgat
cgtttctttgaagaatatgacgtgctgattaatccggtgaatcataaaaaagccctgccc
ctcggtcgttataacggagaagagaaaacaattgatgaaatattatccgtttcggaaata
tacgcctacttgactcccatagcaaatatgacgggacagccggccatgagtgtaccgacg
tactggacgaaagaaaacctgccgatcggttctcatttccaggcccgatacggacgcgac
aaagttctgttccagcttgcgcgtcaacttgaagaagcttttccctggaaagaaaaatat
aaagaaatcagagggtag

DBGET integrated database retrieval system