KEGG   Salimicrobium jeotgali: AAV35_002145Help
Entry
AAV35_002145      CDS       T04359                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sje  Salimicrobium jeotgali
Pathway
sje00071  Fatty acid degradation
sje00072  Synthesis and degradation of ketone bodies
sje00280  Valine, leucine and isoleucine degradation
sje00310  Lysine degradation
sje00362  Benzoate degradation
sje00380  Tryptophan metabolism
sje00620  Pyruvate metabolism
sje00630  Glyoxylate and dicarboxylate metabolism
sje00640  Propanoate metabolism
sje00650  Butanoate metabolism
sje00900  Terpenoid backbone biosynthesis
sje01100  Metabolic pathways
sje01110  Biosynthesis of secondary metabolites
sje01120  Microbial metabolism in diverse environments
sje01130  Biosynthesis of antibiotics
sje01200  Carbon metabolism
sje01212  Fatty acid metabolism
sje02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sje00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AAV35_002145
   00630 Glyoxylate and dicarboxylate metabolism
    AAV35_002145
   00640 Propanoate metabolism
    AAV35_002145
   00650 Butanoate metabolism
    AAV35_002145
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AAV35_002145
   00072 Synthesis and degradation of ketone bodies
    AAV35_002145
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AAV35_002145
   00310 Lysine degradation
    AAV35_002145
   00380 Tryptophan metabolism
    AAV35_002145
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AAV35_002145
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AAV35_002145
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AAV35_002145
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sje04147]
    AAV35_002145
Enzymes [BR:sje01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AAV35_002145
Exosome [BR:sje04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AAV35_002145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKG03706
UniProt: K2GAQ2
Position
427140..428327
Genome map
AA seq 395 aa AA seqDB search
MVKTVIVDGARTAFGKLGGSLSSLSASDLGGKVIAEAMQRAGVEGKDIGEVIMGSVLQGG
QGQLPSRQAARNANIPWHVKTETVNKVCASGMRSVTMGDQFIRLGEEEIIVAGGMESMSS
APYFLPKARFGYRMGDGAVKDMMLHDGLTCSFEGIHMGSYGNRTANKHDISREAQDEWAA
RSHELAGKAIESGVMKEEIVPVEVPQRKGDPISVDTDEAPRLDTTAEKLKKLKPAFDPDG
SITAGNAPGVNDGACAMVLMSDEKAKQQNVKPLATIIAHDEIAVEAQDFPETPGLVINKI
LEKTGKKMEDIDLFEVNEAFAVVSLAGGKIAGLDTDKVNVNGGAVALGHPIGASGARIIL
TLAYELRRRGGGTGIAAICSGGGQGDAVMIEVEGA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaacagtgattgttgatggagcacgtaccgcgtttggcaaactcggaggaagt
ctctcttctttatctgcttcggatcttggcggaaaagtcattgcggaagctatgcagcgt
gccggcgtagaaggtaaggatattggagaagtcattatgggaagcgtacttcagggcgga
cagggacagctgccttcaagacaggcggcccggaatgcgaatataccgtggcatgtgaag
acggaaaccgtcaacaaagtttgtgcttccggtatgcgcagtgtaacgatgggtgatcag
ttcatccgtctcggagaagaggagatcatcgtcgcgggcggcatggaaagtatgagcagt
gctccgtatttccttccaaaagcgaggttcggctatcgtatgggcgatggtgccgtgaaa
gatatgatgcttcacgacggtcttacctgctctttcgagggcatccacatgggaagctac
ggcaaccgcacggctaataagcacgacatttccagagaagcccaggacgaatgggcggcg
cgcagtcatgaacttgccggtaaagcgatcgaatccggcgtgatgaaagaagagattgta
ccggttgaagtaccgcagcgaaaaggtgatccgatcagtgtcgataccgatgaagcaccg
agactggatacgacagcggagaaacttaagaagctgaaacctgctttcgacccggatggc
agtattacggcaggcaacgcacctggtgtgaatgacggagcctgcgcaatggtactgatg
agtgatgagaaagcgaagcagcagaacgttaagccgcttgccacaatcatcgcccacgat
gaaattgcagtggaagctcaggattttcctgaaacaccgggactcgtcattaacaaaatt
cttgaaaaaacaggcaagaaaatggaagatatcgatctgttcgaagtgaacgaagctttt
gcggtcgtgtcactggccggcggtaagattgcaggacttgatacggataaagtgaacgtc
aacggtggtgccgtggcgcttggtcacccgatcggtgcaagtggtgccagaatcattctt
acacttgcctacgaacttcgtcgtcgcggcggcggtaccggaatcgctgctatctgctcc
ggcggaggccagggtgatgcggttatgatcgaagtggagggagcttaa

DBGET integrated database retrieval system