KEGG   Salimicrobium jeotgali: AAV35_005030Help
Entry
AAV35_005030      CDS       T04359                                 

Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
sje  Salimicrobium jeotgali
Pathway
sje00860  Porphyrin and chlorophyll metabolism
sje01100  Metabolic pathways
sje01110  Biosynthesis of secondary metabolites
sje01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sje00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AAV35_005030
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sje01007]
    AAV35_005030
Enzymes [BR:sje01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     AAV35_005030
Amino acid related enzymes [BR:sje01007]
 Aminotransferase (transaminase)
  Class III
   AAV35_005030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AKG04206
UniProt: K2GD48
Position
1022835..1024118
Genome map
AA seq 427 aa AA seqDB search
MKKFGNSISEFKTAKEIMPGGVNSPVRAFNSVNMDALFMEEGKGSKITDIDGNEYIDYVL
SWGPLILGHANEQVVNELKKMVAKGTSFGTPTVIENKLAELVIDRVPSIEMMRMVNSGTE
ATMSALRAARGYTGRDKILKFEGNYHGHGDSLLIKAGSGVATLGLPDSPGVPKSVAENTI
TVPYNDLESVRYAFEQYGDELAAVIVEPVSGNMGVVPPENGFLQGLREITEEHGTVLIFD
EVMSGFRVGYNSAQGHFGVTPDMTCLGKVIGGGLPVGAYGGKREIMETIAPVGKVYQAGT
LSGNPLAMTAGYETLRQMTEETYGTIEQKVDRLVEGFREAADENDIPLAINRAGSMVGVF
FNDNAVTNFETAGNSDTERFAKYYRGMIEEGIFLPPSQFEGLFLSAAHTDEDIEKTISAV
KKVFKTL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtttggtaactctatttctgaattcaaaacagcgaaagagataatgccggga
ggggttaactctcctgtacgtgcctttaattccgtgaacatggacgccctgttcatggaa
gaagggaaagggtctaaaattaccgatattgatggtaatgaatatatcgattatgtactc
agctggggccctctgattctcggccacgccaacgagcaggtagtgaacgaactgaagaag
atggttgcgaaaggtaccagtttcggtactcccacggttattgagaacaagcttgcagag
ctggtcatcgaccgggtaccttccattgagatgatgcgtatggtcaactccggcacagaa
gctactatgagtgctttgcgagcggcgagaggttatacgggtagagataaaatacttaaa
ttcgaagggaactaccatggtcacggagattccttattgattaaggcgggttcgggggta
gcgactctcggccttcctgattcccccggagttcctaaatccgtagccgaaaatacgatt
accgttccgtacaacgatcttgaaagcgtgcgttatgcattcgaacagtacggggacgaa
cttgccgctgtaatcgtggaacctgtgtccggcaatatgggagtcgtaccgccggagaat
ggtttcctccaggggttgcgtgaaattacggaggagcatggaacagtgcttatcttcgac
gaagtcatgagcggtttccgcgtaggttataatagtgctcagggacacttcggtgtaaca
ccggatatgacctgtctcggaaaagtgatcggcggcggcctgccggtcggggcttatgga
ggtaaacgtgaaatcatggaaacgatagctcctgtcggaaaagtatatcaggcaggtacg
ctctccggtaacccgcttgcgatgacggccggttatgagacacttcgtcaaatgactgaa
gagacctacggaacgatcgaacagaaagtggatcgtctggtcgaaggtttccgtgaggcg
gcggacgaaaacgatataccgcttgccatcaaccgtgccggttctatggttggagtattt
ttcaacgataacgctgtcactaattttgaaacagcgggtaattccgatacggaacgtttt
gcgaagtattaccgcgggatgatcgaagaaggtattttccttcctccttcccagttcgaa
ggcctctttttatcagcggcccacacggacgaggacattgagaagacgatcagcgcagtg
aaaaaggtattcaaaacactataa

DBGET integrated database retrieval system