KEGG   Salimicrobium jeotgali: AAV35_006325Help
Entry
AAV35_006325      CDS       T04359                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
sje  Salimicrobium jeotgali
Pathway
sje00670  One carbon pool by folate
sje00790  Folate biosynthesis
sje01100  Metabolic pathways
Module
sje_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sje00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AAV35_006325
   00670 One carbon pool by folate
    AAV35_006325
Enzymes [BR:sje01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     AAV35_006325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AKG04439
UniProt: K2FP77
Position
1274929..1275417
Genome map
AA seq 162 aa AA seqDB search
MISFIFAMDNNRLIGKDNDLPWHIPNDFKFFKTKTMHSTIIMGRKTFESLDGPLPKREHI
IITKDENYEAGDCTVVHSVDEIRAITSGDPEKEWFVIGGTVLFESMLEDVDRMYVTHIDH
SFEGDTYFPEIDWSRWELTDKEKGMRDEKNPYDYFFCIYDRK
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgatttcgtttatttttgcaatggataacaacagacttatagggaaagataatgatctt
ccctggcatattcctaatgacttcaagttctttaagacgaaaacgatgcattctaccatt
atcatgggcaggaagacgttcgaatctctcgacggccctctcccgaaacgggaacatatc
atcattacaaaagatgaaaactacgaagcaggcgactgcaccgtagtccattccgtggac
gaaatacgggctattacttccggagatccagaaaaagaatggttcgtgatcggcgggacg
gtgctgttcgaatcgatgcttgaggatgtcgaccggatgtatgtcacgcatatcgatcat
tctttcgaaggggacacctattttccggagattgactggtcgaggtgggaacttacggac
aaagaaaaaggaatgcgggatgagaagaatccgtacgactattttttctgtatttatgac
aggaaataa

DBGET integrated database retrieval system