KEGG   Salimicrobium jeotgali: AAV35_007615Help
Entry
AAV35_007615      CDS       T04359                                 

Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
sje  Salimicrobium jeotgali
Pathway
sje00020  Citrate cycle (TCA cycle)
sje00620  Pyruvate metabolism
sje01100  Metabolic pathways
sje01120  Microbial metabolism in diverse environments
sje01200  Carbon metabolism
sje01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sje00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AAV35_007615
   00620 Pyruvate metabolism
    AAV35_007615
Enzymes [BR:sje01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     AAV35_007615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl ATP-grasp Dala_Dala_lig_C ATP-grasp_3 Biotin_lipoyl_2 ATP-grasp_4 RimK GCV_H ATPgrasp_ST ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: AKG04678
UniProt: K2GN38
Position
complement(1527574..1531017)
Genome map
AA seq 1147 aa AA seqDB search
MAELRKIEKVLVANRGEIAIRVFRACTELDIRTVAVYSQEDTGSYHRYKADEAYLIGKGK
KPIDAYLDIENIIEVAKEVGVDAIHPGYGFLSENIHFATRCEEEDIKFIGPGSRQLEMFG
DKVKAREQAQKADIPLIPGTDKPVAGVEEVQKFGEEHGYPIIIKASMGGGGRGMRIVRTS
GELEEAFERARGEAKAAFGSEEVYVEKLIENPKHIEVQIIGDEDGNVVHLYERDCSVQRR
HQKVVEMAPSMSLAGTLRENICDAAVKLMRNVGYVNAGTVEFLVADGEFFFIEVNPRVQV
EHTITEMITGIDIVQTQIKVAEGHPLFESYIGIPSQENLVTSGYAIQSRVTTEDPLNNFM
PDTGKIMAYRTGGGFGVRLDAGNGFQGAVISPFYDSLLVKVSTWALTFEQAAQKMVRNLK
EFRIRGIKTNIPFLQNVIQHPQFIKGEYSTTFIDNSPELFVFPKRKDRGTKMLQHIADKT
VNGYDGEGGRKKPDYPDPRVPELPRTDEFPKGTKQILDEEGPEALMNWLKERKEVLLTDT
TFRDAHQSLLATRVRTKDLETIAEPTARLLPELFSLEMWGGATFDVSYRFLNEDPWSRLL
NLREKAPNVLFQMLLRASNAVGYKNYPDNLIEEFVEKSANAGIDVFRIFDSLNWVEGMKP
AIEAVRKTGKIAEAAMCYTGDILDPDRSKYDLDYYVELAGELEEAGAHILGIKDMAGLLK
PEAAYQLISALKKKVSIPVHLHTHDTSGNGIFTYAKAVEAGVDVVDVAAGSMAGMTSQPS
ANSLYYALEGSDRRPGLDIQAYEKLGHYWEDIRDYYEEFESGLRAPHTEVYEHEMPGGQY
SNLQQQAKAVGLGDRWDEVKRMYRRVNNMFGDIVKVTPSSKVVGDMALFMVQNDLNEDDV
YNKGETIDFPDSVIEFFQGYLGQPYQGFPAELQHLVLKGKTPLQDRPGKFLDPVNFKELK
ETLFHKLDRQVTSFDMISYALYPKVYMDYQKFLDQYGDMSMLNTPTFFYGMRLGEEIAVD
IEKGKTLIVKLVSISEAQEDGTRTAFFELNGQPREVVVKDNSITATTAVRPQADKSDEKH
IGASMPGTAVKVMAAAGEKVTKGDHLMVTEAMKMETTVQAPFDGTIKAVHVTDNATIHVG
DLLIEFE
NT seq 3444 nt NT seq  +upstreamnt  +downstreamnt
atggcagaattaaggaagatcgaaaaagtactcgtcgctaaccgcggggaaattgctatc
cgggtatttcgtgcatgtactgagctcgatattagaacagtggcggtttattctcaggaa
gacacaggctcttatcacagatataaagcggatgaagcttatttgatcgggaaaggaaag
aaaccgatcgacgcttacctcgatatcgaaaatatcatagaagtggccaaggaagtaggg
gtggatgccattcacccgggctatggctttttgtctgaaaacatccatttcgcaacacgc
tgtgaagaggaagatatcaaattcataggccccgggagcaggcagcttgaaatgttcggt
gacaaggtgaaggcgagagagcaggcgcaaaaagctgatattccactgattccgggtacc
gacaaacccgtagccggagtggaagaagtacaaaaattcggcgaagaacacggatatccg
attataatcaaagcttctatgggaggcggaggccgcggcatgagaattgtccggacttcc
ggagagctcgaggaagctttcgagagagccagaggagaagcgaaagcggcgtttggcagt
gaagaagtctacgtcgaaaaactaattgaaaatcctaaacatatcgaagtccagatcatc
ggtgatgaagatggaaatgtggtacatctttatgaacgcgactgttccgtgcagcgacgg
catcagaaagtggttgagatggcgccgagtatgtccttggccggcacactgcgggagaat
atttgtgacgcagctgtcaagctgatgcggaatgttggatatgtgaatgccggaactgtg
gaatttctggttgccgatggagaatttttctttattgaagtcaatccgcgggtacaggtg
gaacatacaatcactgaaatgataacaggaattgatatcgttcagactcaaatcaaagtg
gcggaaggccatccattgtttgaaagttacatagggataccatcccaggaaaacttagtt
acgagcggctacgctattcaatcaagagttacgacggaagacccgctgaataacttcatg
cctgacaccggaaaaatcatggcctaccgtaccggaggagggttcggagtacgtctggat
gcaggtaacggatttcagggtgcggtgatttccccgttctacgattccttacttgtaaaa
gtgtctacctgggcccttacatttgaacaggctgcacaaaaaatggtcagaaatttaaaa
gagttccgaattcgtggtatcaaaacaaacattccttttctgcaaaatgttattcaacat
ccgcagtttatcaagggcgaatacagcaccacatttattgacaattctcctgaactattc
gtgtttccgaaaagaaaagaccgcggcaccaaaatgctgcagcacatagctgataaaacg
gtgaacggatatgatggagaaggcggcagaaagaaacctgactatccagatccgcgggtc
ccggaacttccgcgcactgatgaatttccgaaaggtaccaaacagattctggatgaagaa
gggccggaagcactgatgaattggctgaaagaacgaaaagaagtacttcttactgatacg
acgttcagggatgctcatcagtcgctgcttgccaccagggtgagaacaaaagacctcgaa
acgatagcagaacctacggcacgtcttctgcccgaacttttttccttagaaatgtgggga
ggagctacgtttgatgtgtcttaccgctttttgaacgaagatccgtggtcccggctgctt
aacttacgggaaaaagctccgaatgttcttttccagatgctgctccgtgcctccaatgct
gtaggatataaaaactacccggataacctgattgaagaattcgtagagaaaagtgcgaat
gcaggaatagacgtcttccggattttcgacagtctaaactgggtggaaggtatgaaacct
gccatcgaagccgtcagaaagacaggtaaaatagcggaagccgccatgtgttataccggg
gatattctcgatccggaccgttctaaatacgacctggattattatgttgaactggcaggc
gaacttgaagaggcgggtgctcatatcttagggataaaagatatggcaggactccttaaa
cctgaagctgcataccagctgataagtgcgttgaagaagaaagtctccattcctgtgcac
ctccacacccacgacacaagcgggaatggtattttcacgtatgcaaaagcagttgaggct
ggagttgacgtagtggatgttgctgcaggttcaatggcaggaatgacttcccagccgagt
gccaacagtttgtactatgctctcgaaggcagtgacagaaggcccggactggatatacaa
gcttatgagaaactcggacattactgggaagatataagggattattatgaagagtttgaa
agcggtctgcgtgcccctcatactgaagtgtatgaacatgagatgccgggcgggcagtat
tcgaatcttcagcagcaggctaaagccgtaggccttggtgaccggtgggatgaagtcaaa
agaatgtatagacgggtgaataacatgttcggggatatcgttaaagtgaccccttcttca
aaggttgtgggggacatggctttgttcatggtgcaaaatgatctgaacgaagatgacgtg
tataataaaggggaaacgattgatttcccggacagtgtcatcgaatttttccaagggtat
ctgggccagccctaccagggattccctgccgaactccagcacctcgttctgaaaggaaaa
acgcctcttcaagatcggccggggaaatttttagaccctgttaacttcaaagaattgaaa
gagacgctgttccataagctggaccgtcaagtaacaagcttcgatatgataagctatgca
ctttatcctaaagtttacatggattatcagaaattccttgatcagtacggggacatgtcg
atgctgaacactcccacttttttttacggaatgagactgggcgaagaaattgcagtagac
atcgaaaaagggaaaactttgatagtgaaactggtgtccataagtgaagcgcaggaagac
ggaaccagaactgcattttttgagcttaacggacagccgagggaagtagttgtaaaagac
aatagcattactgccactacagccgtgcgaccacaggcggacaaatcagatgaaaagcat
atcggagccagtatgcccggtactgctgtaaaagttatggctgcagcaggtgaaaaggtc
actaaaggggaccatttgatggtgacagaggctatgaaaatggaaacgactgtacaggct
ccttttgacggaacgattaaagccgttcacgtaacagataatgcaactattcacgtggga
gatctacttatcgaatttgaatag

DBGET integrated database retrieval system