KEGG   Salimicrobium jeotgali: AAV35_007950Help
Entry
AAV35_007950      CDS       T04359                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
sje  Salimicrobium jeotgali
Pathway
sje00620  Pyruvate metabolism
sje00630  Glyoxylate and dicarboxylate metabolism
sje01100  Metabolic pathways
sje01110  Biosynthesis of secondary metabolites
sje01120  Microbial metabolism in diverse environments
sje01200  Carbon metabolism
Module
sje_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sje00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AAV35_007950
   00630 Glyoxylate and dicarboxylate metabolism
    AAV35_007950
Enzymes [BR:sje01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AAV35_007950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AKG04740
UniProt: K2FLA1
Position
1598609..1600762
Genome map
AA seq 717 aa AA seqDB search
MENYQSIGTYQVDTVLYQFIEQEVLPGLPLSSKEVWGGLTKILDEFSSENSRLLQTRNQL
QQKIDEYHKSASNEDYLSFLKSIGYLEEKKPDFKISTTNVDSEMKEQAGPQLVVPLTNER
YSLNAANARWGSMYDAYYGTDLIAEEPGIEKGSSYNPERGKEVIRQGRIRLDEWFPLAEG
SHQDAVRYAVVNGELCVELTDRSRKKLKNPFSFLGCQGDCRKPQAILLKHNDLHVELQFD
RNHPVGQIDDAGIKDIQLESAITSIMDCEDSVACVDAEDKIKAYRNWLGLLKGDLTTTFD
KKGETIKRSLHKDRKYRTAEDEELHLKGRALMLVRNVGHLMTNPAVIDNNNNPVYEGLLD
GFFTSLIGMHDLNLRQNSTEGSIYIVKPKMHGSEETAFTNNLFNKIEDVLQLPRYTLKVG
VMDEERRTSLNLHNCIFEVRNRVVFINTGFLDRTGDEIHTSMEKGPMIPKGEMKGSEWLS
AYEAANVRTGIRAGFIKNAQIGKGMWAKPAEMKAMLAEKINHLKAGGNTAWVPSPTAATI
HAMHYHEAYVPDIQNDIPRDDPSEMMLTIPVATPPEDKEVVLNEVRNNAQGILGYVVRWV
EQGIGCSTVPDIHDTGLMEDRATLRISSQHIANWIRHGVVSEEEVKQIMKQMAEVVDRQN
EGDPNYRKMSPDFEQSIAFQAASDLVFLGTDQPNGYTEPILHRRRLQFKASQFTKTV
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaactatcaatccatcggtacttatcaagtcgacactgtattatatcagtttatt
gaacaggaagtgttacccggtctccccctctcttcgaaggaagtgtggggagggctcaca
aaaattcttgatgaattcagctctgaaaacagcagacttttgcagaccagaaaccaatta
caacagaaaatcgatgaataccacaaatcagcttccaatgaagattatctttctttttta
aagtccatcggttatctggaagagaaaaaacccgacttcaaaatcagcacgaccaacgta
gattctgaaatgaaggaacaggccggtccccagctcgtcgtgccactgacaaacgaaaga
tattccctcaatgcagctaacgcacgctggggcagtatgtatgacgcttattacggtaca
gatctgatcgctgaagaacccggtatcgaaaaaggttcttcctacaatcccgagagaggt
aaagaagtaatcagacagggacggattcgactggacgagtggttccctttggcagaagga
agtcaccaggacgcagtgagatatgcggtagtgaacggggaattgtgtgtggaacttact
gaccgttcccgaaagaaacttaaaaaccctttttccttccttggctgtcagggggactgc
cgcaaaccgcaggcaatactgcttaaacataacgaccttcacgttgaactgcagttcgat
cgtaatcacccggtcggccagatagacgatgcaggaattaaggacatccaactggaatcc
gccatcacaagtattatggactgcgaggactccgtcgcatgcgtcgatgccgaagataaa
atcaaagcttatcgtaactggctcgggctgcttaaaggagaccttacgaccacgttcgat
aaaaaaggagaaaccattaaacgctctcttcataaagatcggaaatatcgcactgcggaa
gacgaagagcttcacttgaaaggcagagcacttatgcttgtcagaaacgtaggtcactta
atgacaaacccggcagttatcgacaataacaacaatccggtgtatgagggcctgctcgac
ggtttcttcaccagcctgatcggtatgcacgacctgaacctgagacaaaattcaacggaa
ggttctatttacatcgtcaaaccgaaaatgcacggatcggaagaaacggcttttaccaat
aacctgttcaataaaatagaagatgttctgcaattaccgaggtataccctgaaagtcggg
gtaatggacgaggaacgaagaacttccctgaatcttcacaactgtatttttgaagtgcgc
aaccgggtggtgttcatcaataccggcttcctggatcgtacgggggatgaaatccatacg
tccatggaaaaaggacctatgattcctaaaggagaaatgaaaggaagtgaatggctcagc
gcttacgaagcagccaacgtacgtaccggtataagagcagggttcatcaaaaacgctcaa
ataggtaaagggatgtgggctaaacccgcagagatgaaagctatgcttgcagaaaaaatc
aaccacctgaaagcaggaggaaatacagcatgggtgccgtccccgactgcagccaccatt
catgcgatgcattatcatgaagcatacgtccctgatattcagaatgatatcccgagggat
gacccttccgaaatgatgcttactatcccggtggctactcccccggaagataaagaagtt
gtactgaatgaagtcagaaataatgctcaggggattctcggatatgtcgtgcgctgggtg
gaacagggtatcggctgttcaactgtacctgatatccatgacaccggccttatggaagat
cgtgcaacattgcgcatttcgagtcagcacatagcgaactggatcagacacggtgtagtc
tctgaagaggaggtaaaacagataatgaaacaaatggcagaagtggtcgacagacaaaac
gagggcgatccgaattacaggaaaatgagcccggattttgaacaatctatcgcttttcaa
gccgcttccgaccttgtgtttctcggtacagatcagccaaacggttacactgaaccgatt
cttcacagacgccgccttcaatttaaagccagccaatttaccaaaactgtataa

DBGET integrated database retrieval system