KEGG   Salimicrobium jeotgali: AAV35_008480Help
Entry
AAV35_008480      CDS       T04359                                 

Definition
(GenBank) thiaminase II
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
sje  Salimicrobium jeotgali
Pathway
sje00730  Thiamine metabolism
sje01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sje00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    AAV35_008480
Enzymes [BR:sje01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     AAV35_008480
Transcription factors [BR:sje03000]
 Prokaryotic type
  Other transcription factors
   Others
    AAV35_008480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: AKG04833
UniProt: K2GJF0
Position
complement(1707282..1707968)
Genome map
AA seq 228 aa AA seqDB search
MSFTKELRRENEDVFQAIFDHPFVQGLGEGELPKEAVAHYVKADYEYLNTFLTLYGTAIS
QSDSREDITFFHNQIAFVLGDEIHPHRNLSDYAGTPYENLQGYPMPPTADHYRAHMKSVA
TEGLLGKTIAAMLPCPWTYDEIGKELKRRFSPEPDHPFYEWIEFYADDSIAETTGYMMKR
LDEEAERASPEDRRKMKEAFRKSCQLELAFWEMSYSLEEWPAGKETAR
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttacgaaagaattaagaagagaaaatgaagatgtatttcaggcgattttcgat
cacccgtttgtccagggtcttggcgaaggtgaactgccgaaagaagcggtggctcactac
gtaaaagcggactatgaatacttgaataccttccttaccctttatggcacggccatttcc
caatccgacagtcgggaggatataacattttttcataatcagatcgcctttgtgctgggg
gatgagatacatccacaccgcaatttaagcgattacgcaggcaccccgtacgaaaatctt
cagggttatccgatgccaccgacggcggatcattatcgtgctcacatgaagagtgtggcc
acagaaggtctgctcggaaaaacaattgcggctatgcttccctgtccgtggacttacgat
gaaatcggaaaagaattgaaacggcgtttctctccggaaccggaccatcctttctatgag
tggattgaattctatgccgatgattctattgccgaaaccaccggctacatgatgaaacgt
ctggatgaggaagcggagcgggcatctccggaagacaggcggaaaatgaaagaggctttc
cggaaaagctgtcagttggaactcgctttctgggaaatgtcctattcactggaagaatgg
cctgcaggaaaggagacggcgagatga

DBGET integrated database retrieval system