KEGG   Salimicrobium jeotgali: AAV35_010445Help
Entry
AAV35_010445      CDS       T04359                                 

Definition
(GenBank) L-glutamate gamma-semialdehyde dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
sje  Salimicrobium jeotgali
Pathway
sje00250  Alanine, aspartate and glutamate metabolism
sje00330  Arginine and proline metabolism
sje01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sje00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AAV35_010445
   00330 Arginine and proline metabolism
    AAV35_010445
Enzymes [BR:sje01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     AAV35_010445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AKG05164
UniProt: K2GBN5
Position
complement(2100315..2101862)
Genome map
AA seq 515 aa AA seqDB search
MVAPYKHEPFTDFTVKENKEAFEGALKYVKGELGKQHDLLIDGERIRTDAKIESTNPANT
KEVVGVVSKANKELAEKAVESASEAFEDWRKWDPEARAGILFRAAAIIRRRKHEFSSYLA
YEVGKPWKEADADTAEAIDFLEYYARQAVELKKGKHVESREGEHNQYIYQPIGVTAVIPP
WNLALAIMAGTTVAPLVAGNTVVMKPASNSAVIAAKFVEVLEEAGLPKGVLNFIPGSGGE
VGNAIVDHPKVGLISFTGSRAVGTSIIERASKVQEGQNHLKQVIAEMGGKDTVVVDKEAD
LETAAEAIVVSAYGFSGQKCSSGSRAVVHEDVYDEVLEMVKERTEKLTVGNATEDNVYMG
PVVDQSAYDKVMSYIDIGKEEGRLVTGGKGDNSKGYFIEPTIFADLAPDSRMQQEEIFGP
VVCFTKARDFDEAIDIANNTEYGLTGAVISNNRAHLEKAKYDFHVGNLYFNRNCTGAIVG
YQPFGGFKMSGTDSKAGGPDYIMLHMQAKTVSEMF
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggtagcgccatacaaacacgaaccatttacggattttacagtcaaagaaaacaaggaa
gctttcgagggggctcttaagtatgtaaaaggggaactcggaaagcagcatgatcttcta
attgacggcgagcgtatccgtacagatgcaaaaatagaatcgacgaaccctgcgaacacg
aaagaagtggtaggggtcgtatccaaagcgaataaagaacttgccgaaaaagcggtggag
tctgcatcggaagctttcgaagactggagaaaatgggacccggaagcacgtgccggaatt
cttttccgtgcagctgccatcatccgtcgccgcaagcacgaattttcttcctatcttgct
tatgaagtaggtaaaccatggaaagaagcggatgccgacacggcagaagcgattgatttc
cttgagtattatgcccgccaggctgtagaactgaaaaaagggaaacacgtggaaagccgc
gaaggcgaacacaatcagtatatttatcagcctatcggcgtgacagctgttattccaccg
tggaacctggcgctcgctattatggcaggtacgacagtagcaccactggttgcaggtaat
actgtagttatgaaacctgcttccaacagtgcagtaatcgcagccaaatttgttgaagtg
cttgaagaagccggacttccaaaaggtgttctgaacttcattccgggcagcggtggagaa
gtagggaatgcgattgtggaccacccgaaagtcggtctcatttccttcacaggctcccgt
gctgtcggtacgagcatcattgaacgtgcttcaaaagtccaggaaggccaaaatcatctg
aaacaggttattgccgaaatgggtggtaaagatacggtggtcgtggataaagaagccgat
cttgaaacggctgccgaagctatcgtcgtttccgcctacggtttctccggacagaaatgt
tcttccggttcccgtgctgtcgttcatgaagatgtctatgatgaagtgctggaaatggtg
aaagaacgtacagagaaacttaccgtagggaatgctacagaagataacgtctacatgggc
cctgtagtggatcagagcgcctatgacaaagtgatgagttacatcgacatcggtaaagaa
gaaggccgactggttacaggcggtaaaggggacaactctaaagggtatttcatcgagcct
acaattttcgctgacctggctccggattcccgcatgcagcaggaagagatttttgggcct
gtcgtctgcttcacaaaagcccgtgatttcgatgaagctatcgacatagcgaataatacg
gaatacggattgacaggtgccgtcatttccaataaccgtgctcatcttgaaaaagcgaag
tacgacttccacgtcggaaacctttacttcaaccgtaactgcacaggcgccatcgtcggc
taccagccgttcggcggattcaaaatgtccggtacggattctaaagccggtggacctgac
tatattatgctgcatatgcaggctaaaacagtttcggaaatgttctag

DBGET integrated database retrieval system