KEGG   Sphingobium japonicum: SJA_C1-10820Help
Entry
SJA_C1-10820      CDS       T01201                                 

Gene name
pckA
Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
sjp  Sphingobium japonicum
Pathway
sjp00010  Glycolysis / Gluconeogenesis
sjp00020  Citrate cycle (TCA cycle)
sjp00620  Pyruvate metabolism
sjp01100  Metabolic pathways
sjp01110  Biosynthesis of secondary metabolites
sjp01120  Microbial metabolism in diverse environments
sjp01130  Biosynthesis of antibiotics
sjp01200  Carbon metabolism
Module
sjp_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sjp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SJA_C1-10820 (pckA)
   00020 Citrate cycle (TCA cycle)
    SJA_C1-10820 (pckA)
   00620 Pyruvate metabolism
    SJA_C1-10820 (pckA)
Enzymes [BR:sjp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     SJA_C1-10820 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_25 AAA_24
Motif
Other DBs
NCBI-ProteinID: BAI95916
NITE: SJA_C1-10820
UniProt: D4YZY4
Position
1:1086282..1087898
Genome map
AA seq 538 aa AA seqDB search
MIFRSKGVQAKSPFTLDQQGISTSADQYWNLGTAPLVEAALANGEGILAKDGPLVVKTGK
HTGRSASDKFIVRDAETESTVWWGKTNVPMTPEHFATLKADFFAALGQKDKLYIADLFGG
SQPEHRVNVRVINEFAWHNLFIRTLLVRPGAEELAGFTPEYTIIDLPTFQADPARHGSRS
ETVIAVNFTEKLILIGGTRYAGEMKKSVFGILNYLLPTRGVMPMHCSANIGPDGDTAVFF
GLSGTGKTTLSADASRTLIGDDEHGWSDTAVFNFEGGCYAKMINLSAEAEPEIFATTKRF
GTVLENVVIDEETREIDLDDNSLAENSRGSYPIDFIPNASEKNLGPVPKNIIFLTADAYG
VLPPIARLTPEQAMYHFLSGYTARVAGTEIGVTEPTATFSTCFGAPFMPRHPSVYGNLLK
ERINKGGVTCWLVNTGWTGGKYGVGKRMPIKVTRALLNAALDGSLNNAEFRVDPNFGFQV
PVAVPGVDSTILDPRATWDDKAAYDETAGKLVKQFVDNFAQFEDHVDASVREAALTAA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgatattcaggagtaaaggcgtgcaggccaaatcccctttcaccctcgatcagcagggt
atttccaccagcgctgatcaatattggaatctgggcaccgcgccgctggtcgaagccgcg
cttgccaatggcgaaggcattttggccaaggacggcccgctggtcgtcaagaccggcaag
cataccggccggtcggcgagcgacaagttcatcgtccgggacgcggaaaccgaatccacc
gtctggtggggcaagaccaacgtgcccatgacgccggagcatttcgcgacgctgaaggcc
gatttcttcgccgcgctggggcagaaggacaagctctacatcgccgacctgttcggcgga
tcgcagcccgaacatcgcgtcaacgtgcgcgtcatcaacgaattcgcctggcacaacctg
ttcatccgcacgctgctggtccgtccgggcgcggaggagttggccggcttcacccccgaa
tatacgatcatcgacctgccgaccttccaggccgatccggcccgccacggcagccgcagc
gaaaccgtcatcgcggtcaacttcaccgagaagctgatcctgatcggcggcacgcgctat
gccggcgaaatgaagaaatccgtcttcggcatcctcaactatctgctgcccacccgcggc
gtgatgccgatgcactgttcggccaatatcggccccgatggcgacaccgccgtcttcttc
ggcctgtcgggcacgggcaagaccaccctgtcggccgacgccagccgcaccctgatcggc
gatgacgagcatggctggtcggacacggcggtcttcaatttcgagggcggctgctacgcc
aagatgatcaacctgtcggccgaggccgagcctgagatcttcgccaccaccaagcggttc
ggcacggtgctggaaaatgtcgtgatcgacgaggaaacccgcgagatcgacctggacgac
aacagcctggccgaaaacagccgcggttcctaccccatcgacttcatcccgaatgcgtcg
gagaagaatctggggccggtgccgaagaacatcatcttcctgaccgccgatgcctatggc
gttctgccgccgatcgcgcggctgacgccggaacaggccatgtatcacttcctttcgggc
tatacggcgcgggtcgccgggaccgagatcggcgtgacggagccgacggccaccttctcg
acctgcttcggcgcgcccttcatgccgcgccatccctccgtctacggcaatctgctgaag
gaacggatcaacaagggcggcgtgacctgctggctggtcaacaccggctggaccggcggc
aaatatggcgtcggcaagcggatgccgatcaaggtgacccgcgccctgctgaacgccgcg
ctggacggcagcctcaacaatgccgaattccgcgtcgatccgaatttcggtttccaggtg
ccggtcgcggtgccgggcgtggattcgaccatcctcgatccgcgcgcgacctgggacgac
aaggcggcctatgacgaaaccgccggcaagctggtcaagcagttcgtcgacaatttcgcc
cagttcgaggaccatgtcgacgcatcggtgcgcgaggcggccctgaccgccgcctga

DBGET integrated database retrieval system