KEGG   Sphingobium japonicum: SJA_C1-11210Help
Entry
SJA_C1-11210      CDS       T01201                                 

Gene name
rfbB
Definition
(GenBank) dTDP-glucose 4,6-dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
sjp  Sphingobium japonicum
Pathway
sjp00520  Amino sugar and nucleotide sugar metabolism
sjp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sjp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SJA_C1-11210 (rfbB)
Enzymes [BR:sjp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     SJA_C1-11210 (rfbB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 NAD_binding_10 adh_short KR UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: BAI95955
NITE: SJA_C1-11210
UniProt: D4Z023
Position
1:1120560..1121621
Genome map
AA seq 353 aa AA seqDB search
MKNDRTEKDGGSMNGKRETALVAGGAGFIGSHLCRTLLDQGHEVICLDNLQTSREVNLRM
LEGHRAFTFVRGDIVDPLPDAVTRRRDISRIYNLACAASPPQYQADPEHTMLTSVVGTDR
LLRLAEQVGARFLLTSTSEVYGDPEAHPQREDYRGWVNCTGPRACYDEGKRAAEAMAFDF
ARLGRADVRVARIFNTYGPNMHPDDGRVISNLVCQALSGDAITIYGDGSQTRSFCFVSDM
VDGLIRLMEAPLSDMAPVNLGNPEEYSILQLLDQVVAATGTRSQVVFQPLPVDDPRRRRP
DIRRASQLLGWEPRVPLSEGLAITCAFFEKELYDRAPGFACASFVEGAGIAAE
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacgacaggacagaaaaggacggagggtcgatgaacggaaagcgtgaaacagcc
ctggtggccggaggagccggcttcatcgggtcgcatctgtgccggacgctgctggatcaa
gggcatgaggtcatctgcctcgacaacctccagacctcgcgggaggtcaacctgcggatg
ctggaggggcatcgcgccttcaccttcgtgcgcggcgacatcgtcgatcccctgcccgat
gcggtcacgcgccggcgcgacatcagccgcatctacaatctcgcctgcgcggcttcgccg
ccgcaatatcaggccgatcccgaacatacgatgctgaccagcgtggtcggaaccgatcgc
ctgctgcggctggcggagcaggtcggcgcgcgcttcctgctcacctccaccagcgaggtc
tatggcgatccggaggcgcatccccagcgggaggattatcgcggctgggtgaactgtacc
ggcccccgcgcctgctatgacgagggcaagcgcgcggcggaggccatggccttcgacttc
gcccggctgggccgcgccgatgtccgggtggcgcggatcttcaacacctatggcccgaac
atgcatcccgacgatggccgcgtgatctccaacctcgtctgccaggcgttgtcgggcgac
gccatcaccatctatggcgacggatcgcagacgcgcagcttctgcttcgtgtcggacatg
gtcgacgggctgatccgattgatggaggcgcccttgtccgacatggcgcccgtcaatctg
ggcaatccggaggaatacagcatcctgcaactgctggaccaggtggtggcggccaccggc
acgcggtcgcaggtcgtcttccagccgctgccggtggacgatccgcgccggcgcaggccg
gacatccgccgggcgagccagttgcttggttgggaaccccgcgttcccctgagcgagggg
ctggcgatcacctgcgccttttttgagaaggaactttatgaccgcgcgccgggattcgca
tgcgcgtccttcgtcgaaggggcgggcatcgcggcggaatga

DBGET integrated database retrieval system