KEGG   Sphingobium japonicum: SJA_C1-16980Help
Entry
SJA_C1-16980      CDS       T01201                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sjp  Sphingobium japonicum
Pathway
sjp00071  Fatty acid degradation
sjp00072  Synthesis and degradation of ketone bodies
sjp00280  Valine, leucine and isoleucine degradation
sjp00310  Lysine degradation
sjp00362  Benzoate degradation
sjp00380  Tryptophan metabolism
sjp00620  Pyruvate metabolism
sjp00630  Glyoxylate and dicarboxylate metabolism
sjp00640  Propanoate metabolism
sjp00650  Butanoate metabolism
sjp00900  Terpenoid backbone biosynthesis
sjp01100  Metabolic pathways
sjp01110  Biosynthesis of secondary metabolites
sjp01120  Microbial metabolism in diverse environments
sjp01130  Biosynthesis of antibiotics
sjp01200  Carbon metabolism
sjp01212  Fatty acid metabolism
sjp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sjp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SJA_C1-16980 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    SJA_C1-16980 (atoB)
   00640 Propanoate metabolism
    SJA_C1-16980 (atoB)
   00650 Butanoate metabolism
    SJA_C1-16980 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SJA_C1-16980 (atoB)
   00072 Synthesis and degradation of ketone bodies
    SJA_C1-16980 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SJA_C1-16980 (atoB)
   00310 Lysine degradation
    SJA_C1-16980 (atoB)
   00380 Tryptophan metabolism
    SJA_C1-16980 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SJA_C1-16980 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SJA_C1-16980 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SJA_C1-16980 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sjp04147]
    SJA_C1-16980 (atoB)
Enzymes [BR:sjp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SJA_C1-16980 (atoB)
Exosome [BR:sjp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SJA_C1-16980 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C 3HCDH ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: BAI96532
NITE: SJA_C1-16980
UniProt: D4Z1Q0
Position
1:1698776..1699954
Genome map
AA seq 392 aa AA seqDB search
MPLSDIVITAAKRTAVGGFMGAFGSTPAHELGRTAILAALAQAGVAPEEVDEVILGQVLT
AGQGQNPARQAAVNAGIPVERTAIGVNQLCGSGLRAVALAAQAIRAGDARIMVAGGQESM
SLAPHAQYLRGGAKMGPISLVDTMTHDGLTDAFNNYHMGITAENLAEKYQISREAQDVFS
VGSQNKAEAARASGRFKDEIAPVTVKGRKGDTIVDTDEYIRAGATLEAMQSLRPAFRKDG
TVTAANASGINDGAAALVLMSAEEAAKRDALVLARIASFATCGVDPSIMGIGPAPASRQA
LAKAGWSLADLDLIEANEAFAAQALAVGQELGWDAEKVNVNGGAIAIGHPIGASGARVLT
TLIYEMQKRDAKKGLATLCIGGGMGVAMCIER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcccttgtcagacatcgtcatcaccgccgccaagcgcaccgccgtcggcggcttcatg
ggcgccttcggatcgacgcccgcgcatgagttgggccgtaccgccatcctcgccgccctc
gcccaggcgggcgtcgcgccggaggaggtggacgaggtcatattgggccaggtcctgacc
gccggccaggggcagaaccccgcccgccaggccgccgtcaacgccggcatcccggtcgag
cgcaccgccatcggcgtcaaccagctttgcggttcgggcctgcgcgccgtcgcgttggcg
gcgcaggcgatccgcgccggcgacgcccgcatcatggtcgcgggcgggcaggaaagcatg
tcgctcgccccgcacgcccaatatctgcgcggcggcgcgaaaatgggtccgatctccctg
gtcgacacgatgacgcatgacggcctgaccgacgccttcaacaattatcacatgggcatc
acggcggaaaatctggcggagaaatatcagatcagccgcgaagcgcaggacgtcttctcc
gtcggcagccagaacaaggcggaggccgcccgcgcatcgggccgtttcaaggacgagatc
gcgcccgtgaccgtcaagggccgcaagggcgacaccattgtcgacacagacgaatatatc
cgcgccggcgccacgctggaggcgatgcagagcctgcgtcccgcgttcaggaaggacggc
accgtcaccgccgccaatgccagcggcatcaacgacggcgcggccgccctggtcctgatg
agcgcggaagaagcggcgaagcgcgacgcgctcgtgctggcccgcatcgccagtttcgcg
acctgcggcgtcgatccgtcgatcatgggcatcggcccggctccggcgagccgccaggcg
ctggccaaggctggctggtcgctggcagacctggacctgatcgaggccaatgaagccttc
gccgcgcaggcgctggcggttggccaggaactgggctgggacgcggaaaaggtcaatgtg
aacggcggcgccatcgccatcggccacccgatcggcgcttcgggcgcgcgcgtgctcacc
accctgatctacgaaatgcagaagcgcgacgcgaagaagggccttgccacgctttgcatc
ggcggcggcatgggcgtcgccatgtgcatcgaacgttga

DBGET integrated database retrieval system