KEGG   Sphingobium indicum UT26S: SJA_C1-19910
Entry
SJA_C1-19910      CDS       T01201                                 
Symbol
virB9
Name
(GenBank) type IV secretory pathway VirB9 component
  KO
K20532  type IV secretion system protein TrbG
Organism
sjp  Sphingobium indicum UT26S
Pathway
sjp02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sjp00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SJA_C1-19910 (virB9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sjp02044]
    SJA_C1-19910 (virB9)
Secretion system [BR:sjp02044]
 Type IV secretion system
  Trb secretion system protein
   SJA_C1-19910 (virB9)
SSDB
Motif
Pfam: CagX
Other DBs
NCBI-ProteinID: BAI96825
NITE: SJA_C1-19910
UniProt: D4Z2J3
Position
1:complement(1988465..1989532)
AA seq 355 aa
MTPALHKAAPWSAGRPAFLINAIPAFRKSGLPLLLLYTSALAGCAGHMPPPEISYDDAMP
AVQAADPPKPVQIVELPKPLPLPGQLKPVGKDAKPEPEAVDPTARVNQANAAARVQPVRN
GFINSMQVYPFVDGALYQVYASPGQITDIGLQPGEQLVGSGPVAAGDTVRWIIGDTESGT
GAAKQVHILVKPTRADLMTNLVINTDRRTYHMELRSTPTTYMASVSWQYPQDQLIALRRQ
NQQAEATQPVANGIDLARVNFRYEVTGDRAPWRPLRAFDDGKQIFIEFPRGIGQGEMPPL
FVVGPEGDTSELVNYRVRGNYMIVDRLFAAAELRFGADKNQKRVRISRTDGRPAS
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgacgccagcactccacaaagccgccccctggagtgcagggcgtccggctttcctcatc
aacgccattccggctttccgtaaatccggcttgccgcttctcctgctttacacctcggcg
ctcgccggatgcgctggccacatgccgccgccggaaatctcctacgacgacgccatgccc
gccgtgcaggccgccgatccgcccaagccggtgcagatcgtggagttgccgaaaccacta
ccgcttcccggacagttgaagcctgtcggcaaggatgccaagcccgagccggaagccgtc
gatccgaccgcgcgggtcaaccaggccaatgcggccgcgcgcgtgcagccggtacgcaac
ggcttcatcaattcgatgcaggtctatcccttcgtcgatggcgccctctatcaggtctat
gcctcgccgggacagatcaccgacatcggcctccagcctggcgaacagctcgtgggttct
ggccctgtcgccgccggcgacaccgtgcgctggatcatcggcgacaccgagagcgggacg
ggtgcggccaagcaggtccatatcctcgtcaaaccgacgcgcgccgacctcatgacgaat
ctcgtcatcaataccgaccgccgcacctatcatatggaattgcgctcgacgcccacgacc
tacatggcgtcggtatcctggcaatatccgcaagaccagctcatcgcgctgcgccgtcag
aaccaacaggcggaggccacgcagcccgttgcgaacggcatcgatctcgcccgcgtcaac
ttccgctatgaggtgacaggcgaccgtgccccgtggcgaccgctgcgcgcctttgatgac
ggcaagcagatattcatcgagtttccgcgcgggatcggccagggcgagatgccgcctctg
tttgtcgtcggcccggaaggtgacacctctgaactcgtgaactaccgcgtgcgcggcaac
tacatgatcgtcgataggctctttgccgccgccgaactgcgtttcggagccgacaagaat
cagaagcgcgtccgcatctcccgcaccgacgggaggcccgcgtcgtga

DBGET integrated database retrieval system