KEGG   Sphingobium indicum UT26S: SJA_C1-19980
Entry
SJA_C1-19980      CDS       T01201                                 
Symbol
virB2
Name
(GenBank) type IV secretory pathway VirB2 component
  KO
K20528  type IV secretion system protein TrbC
Organism
sjp  Sphingobium indicum UT26S
Pathway
sjp02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sjp00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SJA_C1-19980 (virB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sjp02044]
    SJA_C1-19980 (virB2)
Secretion system [BR:sjp02044]
 Type IV secretion system
  Trb secretion system protein
   SJA_C1-19980 (virB2)
SSDB
Motif
Pfam: TrbC Cytomega_UL20A
Other DBs
NCBI-ProteinID: BAI96832
NITE: SJA_C1-19980
UniProt: D4Z2K0
Position
1:complement(1995491..1995832)
AA seq 113 aa
MMPAVQRLRLARRRLAMTVSIATLSVVMAAPAHASGSSMPWEQPLQQILQSIEGPVAKII
AVIIIITTGLTLAFGDTSGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGALV
NT seq 342 nt   +upstreamnt  +downstreamnt
atgatgcctgccgttcaacgcctgcgccttgcgcgccgccgtctcgccatgaccgtttcc
atcgccacgctttccgttgtgatggccgcgcccgcccatgcctccggctcatcgatgccg
tgggaacaaccgctccagcaaatcctccagtcgatcgaaggcccggtcgccaagatcatc
gccgtcatcatcattatcacgaccggcctgacgctggcctttggcgacacatcgggcggc
ttccgccgcctgattcagatcgtgttcggcctgtcgatcgctttcgccgcgtcgagcttc
ttcctgtcgttcttctcgttcggcggtggggcgctggtctga

DBGET integrated database retrieval system