KEGG   Sphingobium japonicum: SJA_C1-20710Help
Entry
SJA_C1-20710      CDS       T01201                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sjp  Sphingobium japonicum
Pathway
sjp00071  Fatty acid degradation
sjp00280  Valine, leucine and isoleucine degradation
sjp00281  Geraniol degradation
sjp00310  Lysine degradation
sjp00360  Phenylalanine metabolism
sjp00362  Benzoate degradation
sjp00380  Tryptophan metabolism
sjp00410  beta-Alanine metabolism
sjp00627  Aminobenzoate degradation
sjp00640  Propanoate metabolism
sjp00650  Butanoate metabolism
sjp00903  Limonene and pinene degradation
sjp00930  Caprolactam degradation
sjp01100  Metabolic pathways
sjp01110  Biosynthesis of secondary metabolites
sjp01120  Microbial metabolism in diverse environments
sjp01130  Biosynthesis of antibiotics
sjp01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sjp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SJA_C1-20710
   00650 Butanoate metabolism
    SJA_C1-20710
  Lipid metabolism
   00071 Fatty acid degradation
    SJA_C1-20710
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SJA_C1-20710
   00310 Lysine degradation
    SJA_C1-20710
   00360 Phenylalanine metabolism
    SJA_C1-20710
   00380 Tryptophan metabolism
    SJA_C1-20710
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SJA_C1-20710
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SJA_C1-20710
   00281 Geraniol degradation
    SJA_C1-20710
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SJA_C1-20710
   00627 Aminobenzoate degradation
    SJA_C1-20710
   00930 Caprolactam degradation
    SJA_C1-20710
Enzymes [BR:sjp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SJA_C1-20710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: BAI96905
NITE: SJA_C1-20710
UniProt: D4Z2S3
Position
1:2065031..2066089
Genome map
AA seq 352 aa AA seqDB search
MTDQVLISLDNGVGRIRLNRPKAIHALTTEMCDAIIAALLAWREDESVVAVMLDHAEGRG
FCAGGDIAMIANSARGDCSEAEQFFFTEYRMNHLLFVYEKPIVAFIDGIVMGGGVGISDP
ARYRVATERTTYAMPETGIGLFPDVGGGWFLPRLPGRTGAWLATTGARIKGADCAAIGIA
THYMASDKLEAVKARIVADPDGLAEILDEMADVPPPSAWEAHRGEIDRLFASDRFEDILA
ALEAEGSDWAREQLATLATKSPQTIKVALRQMAEGAAFTDFADNMRNEYRIGHHVIRRPD
FIEGVRAVIFDKDNAPRWNPARAEDVTDELVDSLFAPLPPEKEWTPLPQLRG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcaggttctgatttcactcgataatggcgtggggcggataaggctgaaccgg
cccaaggcgatccatgcgctgaccaccgaaatgtgcgacgcgatcattgcggcgctgctg
gcctggcgggaggatgagagcgtcgtcgcggtgatgctggaccatgccgagggtcgcggt
ttctgcgcgggcggcgacatcgccatgatcgcgaacagcgccaggggcgactgttcggag
gcggagcagttcttcttcaccgaatatcggatgaaccacctgctgttcgtctatgaaaag
ccgatcgttgccttcatcgacggcatcgtcatgggcgggggcgtggggatttccgatccg
gcgcgctatcgcgtggcgacggagcggacaacctatgccatgccggaaacgggcatcggg
ctgtttcccgatgtgggcggcggctggttcctgccgcgcttgccggggcggaccggggcg
tggctggcgacgacgggggcgcggatcaagggcgcggattgcgcggccatcggcatcgcg
acccattatatggcttcggacaagctggaggcggtaaaggcgcggatcgtcgccgatccg
gacggactggccgagatattggacgagatggccgacgtgccgccgccttcggcctgggaa
gcgcatcggggcgagatcgaccggctgttcgcttcggatcggttcgaggatattctggcg
gcgctggaggctgaggggtcggactgggcgcgggagcagcttgccaccctggccaccaag
tcgccgcagacgatcaaggtcgccctgcggcagatggcggagggcgcggccttcaccgac
ttcgccgacaatatgcgcaacgaatatcgcatcggccatcatgtcattcgccgtcccgat
ttcatcgagggcgtgcgggcggtgatcttcgacaaggataatgcgccgcgatggaatccg
gcgcgggcggaggatgtgacggacgaactggtcgacagcctgttcgcgcccctgcctccg
gaaaaggaatggacgccgctgcctcaattgcgcggctga

DBGET integrated database retrieval system