KEGG   Sphingobium japonicum: SJA_C1-22360Help
Entry
SJA_C1-22360      CDS       T01201                                 

Gene name
apaG
Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
sjp  Sphingobium japonicum
Brite
KEGG Orthology (KO) [BR:sjp00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    SJA_C1-22360 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: BAI97070
NITE: SJA_C1-22360
UniProt: D4Z388
Position
1:complement(2254546..2254944)
Genome map
AA seq 132 aa AA seqDB search
MNALFPFHATTRDINVHVAVTFLPEQSEPDRGRWFWAYHIRIENDGDQPVQLLTRHWIIT
DGRGAQHRVDGDGVVGEQPVVQPGKSYDYVSGCPLNTPTGSMKGHYHMIGASGETFDIAI
PHFALIAPAVAE
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcacttttccccttccacgcgacgacgcgcgacatcaacgtgcacgtcgccgtc
accttcctgcccgaacagtcggaaccggaccggggccgatggttctgggcctatcatatc
cgcatagagaatgacggggatcagccggtgcaacttctcacccggcactggatcatcacc
gacgggcggggcgcgcagcatcgggtcgacggagacggggtcgtgggggaacagccggtg
gtgcagccgggcaagagctatgactatgtgtccggctgcccgctcaacacgccgaccggc
tccatgaagggccattatcacatgatcggcgccagcggcgagacgttcgacatcgccatc
ccccacttcgcgctgatcgcgcccgcggtggccgaatga

DBGET integrated database retrieval system