KEGG   Sphingobium indicum UT26S: SJA_C1-29690
Entry
SJA_C1-29690      CDS       T01201                                 
Symbol
trbC
Name
(GenBank) conjugal transfer protein TrbC
  KO
K20528  type IV secretion system protein TrbC
Organism
sjp  Sphingobium indicum UT26S
Pathway
sjp02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sjp00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SJA_C1-29690 (trbC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sjp02044]
    SJA_C1-29690 (trbC)
Secretion system [BR:sjp02044]
 Type IV secretion system
  Trb secretion system protein
   SJA_C1-29690 (trbC)
SSDB
Motif
Pfam: TrbC
Other DBs
NCBI-ProteinID: BAI97803
NITE: SJA_C1-29690
UniProt: D4Z5C1
Position
1:complement(2959595..2959882)
AA seq 95 aa
MLAAGLAMASAAAHAAGSGMPWEQPLEQVLESVQGPVAKIVAVIIIITTGLTLAFGETSG
GFRRLIQIVFGLSIAFAASSFFLSFFSFGGGALVA
NT seq 288 nt   +upstreamnt  +downstreamnt
atgctcgccgctggccttgccatggcttcggccgccgcgcatgccgccggctccggcatg
ccctgggaacagccgctcgaacaggtgctggaatcggtgcagggaccggtggcgaagatc
gtcgccgtgatcatcatcatcacgaccggcctcacgcttgcctttggtgagacctcgggt
ggatttcgccgcctgatccagatcgtcttcggcctttccatcgcttttgccgcatcgtcc
ttcttcctttcctttttcagcttcggcggcggggcgctcgtggcatga

DBGET integrated database retrieval system