KEGG   Sphingobium japonicum: SJA_C2-03970Help
Entry
SJA_C2-03970      CDS       T01201                                 

Gene name
fadA
Definition
(GenBank) acetyl-CoA acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sjp  Sphingobium japonicum
Pathway
sjp00071  Fatty acid degradation
sjp00072  Synthesis and degradation of ketone bodies
sjp00280  Valine, leucine and isoleucine degradation
sjp00310  Lysine degradation
sjp00362  Benzoate degradation
sjp00380  Tryptophan metabolism
sjp00620  Pyruvate metabolism
sjp00630  Glyoxylate and dicarboxylate metabolism
sjp00640  Propanoate metabolism
sjp00650  Butanoate metabolism
sjp00900  Terpenoid backbone biosynthesis
sjp01100  Metabolic pathways
sjp01110  Biosynthesis of secondary metabolites
sjp01120  Microbial metabolism in diverse environments
sjp01130  Biosynthesis of antibiotics
sjp01200  Carbon metabolism
sjp01212  Fatty acid metabolism
sjp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sjp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SJA_C2-03970 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    SJA_C2-03970 (fadA)
   00640 Propanoate metabolism
    SJA_C2-03970 (fadA)
   00650 Butanoate metabolism
    SJA_C2-03970 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SJA_C2-03970 (fadA)
   00072 Synthesis and degradation of ketone bodies
    SJA_C2-03970 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SJA_C2-03970 (fadA)
   00310 Lysine degradation
    SJA_C2-03970 (fadA)
   00380 Tryptophan metabolism
    SJA_C2-03970 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SJA_C2-03970 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SJA_C2-03970 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SJA_C2-03970 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sjp04147]
    SJA_C2-03970 (fadA)
Enzymes [BR:sjp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SJA_C2-03970 (fadA)
Exosome [BR:sjp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SJA_C2-03970 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: BAI98760
NITE: SJA_C2-03970
UniProt: D4Z8E1
Position
2:complement(485840..487045)
Genome map
AA seq 401 aa AA seqDB search
MPEAFIFDAVRTPRGRGKPDGSLHEISALELAAQTLGAIRDRHRLDTSLVDDVILGCVMP
VGEQGADIARLAVLAADYAQSTAGVQVNRFCGSGLEACNMAAAKVVFGEAEFAIGGGVES
MSRVAMGADGGAMAVDPSFAYDSYFTPQGIGADLIATLDGFSREDVDGYAVESQRRAARA
WAEGRFSRSVVPVVDQAGVTRLDHDEHIRADATIDSLATLKPSFKAMGETLFDPVAIQRY
PEISQVDHVHHAGNSSGIVDGASAVLIGSREAGEKAGLKPRAKILGAASIGSEPTIMLTG
PSYVTEKLLKRLGMAVADIDLFELNEAFAAVVLRYMKMLDIPHDKINVNGGAIAMGHPLG
ATGGMILGTVLDELERSGKETAVINLCVGAGMGTAMAIARV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgccagaagccttcatcttcgacgccgttcgcacgcccagagggcgcgggaaacccgac
ggctcgcttcacgagatcagcgcgctggagcttgccgcgcagacgctgggcgccattcgc
gatcgccatcgactggacacgtcgctggtggacgacgtgatcctgggctgcgtcatgccg
gtgggcgaacagggcgcggacatcgcccggctcgccgtgctggcggccgactatgcgcag
tccaccgccggggtccaggtcaaccgcttctgcggatcggggcttgaggcgtgcaacatg
gcggctgccaaggtggtgttcggtgaagccgaattcgccatcggcggcggcgtcgaatcc
atgtcgcgcgtggcgatgggggccgatggcggggcgatggcggtcgatcccagcttcgcc
tatgacagctatttcacgccccagggcatcggcgccgacctgatcgccacgctcgacgga
ttcagccgcgaggatgtcgacggctatgcagtggaaagccagcgccgggcggcgcgcgcc
tgggcggaagggcgcttttcccgttcggtcgttccggtggtcgaccaggccggcgtcacg
cggctcgaccatgacgaacatatccgcgccgacgcgacgatcgactcgctcgccacgctc
aagccctccttcaaggcgatgggcgagacgctgttcgacccggtggcgatccagcgctat
ccagaaatcagccaggtcgaccatgtccaccatgccggcaattccagcggcatcgtcgac
ggcgcgtcggcggttctgatcggatcgcgcgaggccggcgaaaaggccggcttgaagccg
cgggccaaaatcctgggcgcggcctccatcggatcggagccgacgatcatgctgaccggc
ccgtcctatgtcactgaaaagctgctgaagcggctgggcatggcggtggccgacatcgac
cttttcgaactgaacgaggccttcgcggcggtggtgctgcgctacatgaagatgctcgac
atcccgcatgacaagatcaacgtgaacggcggcgcgatcgccatgggccatccgctgggc
gcgaccggcgggatgatcctgggaaccgtgctggacgaactggaacggtccggcaaggaa
acggccgtgatcaatttgtgcgtcggcgcgggcatgggcaccgcaatggccatcgcgcgc
gtctga

DBGET integrated database retrieval system