KEGG   Sphingobium indicum UT26S: SJA_P1-01030
Entry
SJA_P1-01030      CDS       T01201                                 
Name
(GenBank) hypothetical protein
Organism
sjp  Sphingobium indicum UT26S
SSDB
Motif
Pfam: TraL Syndecan
Other DBs
NCBI-ProteinID: BAI99055
NITE: SJA_P1-01030
UniProt: D4Z8X3
Position
pCHQ1:79698..79964
AA seq 88 aa
MDERLPQYLHRPVQILWFGSDEFILVMSTIFVAVIVGGVIGWTLIGALLLFIPWKRTKPR
GFIPHLAWRWGLLRFRHYPGPTQTRFFE
NT seq 267 nt   +upstreamnt  +downstreamnt
ttggacgaacgtctgccccagtatctccatcggccggtgcagatcctctggttcggctcg
gacgagttcatattggtcatgtcgaccatcttcgtcgccgtcatcgtcggcggagtgatc
ggctggacgctgatcggcgctcttctccttttcattccctggaagcgcaccaagccgcgc
gggttcatcccgcatctcgcctggcgttggggcctgctgcgcttccgtcactatccgggt
ccgacacagacccgcttcttcgagtga

DBGET integrated database retrieval system