KEGG   Sphingobium indicum UT26S: SJA_P1-01050
Entry
SJA_P1-01050      CDS       T01201                                 
Name
(GenBank) putative exported protein
  KO
K12066  conjugal transfer pilus assembly protein TraK
Organism
sjp  Sphingobium indicum UT26S
Brite
KEGG Orthology (KO) [BR:sjp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sjp02044]
    SJA_P1-01050
Secretion system [BR:sjp02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   SJA_P1-01050
SSDB
Motif
Pfam: TraK
Other DBs
NCBI-ProteinID: BAI99057
NITE: SJA_P1-01050
UniProt: D4Z8X5
Position
pCHQ1:80595..81383
AA seq 262 aa
MPIADRSGVARPYAQAAALIAFAAVIAGQAQAQSITALPDQTSSIRLSNRDINHVVCEGG
EIEDVKFSAEKAIAVERAGSDAWIKFLVKEVETEGVPTRTYATAASEFFISCNGAVYPLY
AEPSDIPAQTVILTPGAAQRARTNADLLGPLVEEERAVSITLALLQDRVPASFSEVAPIA
RDFALPSLPAASLHERRRISIDGAGLSASEYLVSVSAAQRIDERAFLVSNLGANIFAITL
DRTDLRAGDTARLIVVRRGAVQ
NT seq 789 nt   +upstreamnt  +downstreamnt
atgccgatcgctgatcgatccggcgtggcacgtccctacgcacaagccgccgctcttatc
gcctttgccgccgtgatcgccggccaggcccaggcccaatccatcacggcactgcccgat
cagacaagcagcatccgcctctccaatcgcgacatcaaccatgtcgtctgcgaaggcggc
gagatcgaggatgtcaaattctcggccgagaaggcgatagcggtcgaacgtgctggatct
gacgcctggatcaaattcctggtgaaggaggtcgaaaccgagggcgtgccaacccgcacc
tacgcgacggccgcatctgaattctttatcagctgcaatggggcggtctatccgctctat
gccgagccgtccgatatccccgcgcagacagtaatcctgacgccgggcgctgcccagcgc
gcccgaaccaacgccgatttactcggtcctctggtcgaggaagaacgcgcggtctcgatc
actctggccctgctgcaggaccgcgttcccgcaagtttctccgaggtagcgcccatcgcg
cgcgattttgccctgccctctctgccggccgcatcgctgcatgaaaggcggcggatctcg
atcgacggcgcggggctttccgcgagtgaatatctcgtcagcgtatcggcggcccagcgc
atcgacgagcgagcgtttctggtttcgaacctcggcgccaatattttcgcgattacgctc
gatcgcacggatcttcgcgcaggcgataccgcccggctgatcgtggtgcgccgaggagcg
gtccaatga

DBGET integrated database retrieval system