KEGG   Sphingobium indicum UT26S: SJA_P1-01060
Entry
SJA_P1-01060      CDS       T01201                                 
Symbol
traB
Name
(GenBank) conjugal transfer protein TraB
  KO
K12065  conjugal transfer pilus assembly protein TraB
Organism
sjp  Sphingobium indicum UT26S
Brite
KEGG Orthology (KO) [BR:sjp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sjp02044]
    SJA_P1-01060 (traB)
Secretion system [BR:sjp02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   SJA_P1-01060 (traB)
SSDB
Motif
Pfam: TrbI
Other DBs
NCBI-ProteinID: BAI99058
NITE: SJA_P1-01060
UniProt: D4Z8X6
Position
pCHQ1:81380..82708
AA seq 442 aa
MSGEREEIAPEDGAPIEHSPYQQRLAEQASLDLDVPPPGSSWDAVRARWDGLSSRQKLRA
KQLGVAAAIGVLGYGLYSASSSDTPAATAPAASKLDMGAGLRGDSLEVKLRGDLKKVLDG
QNLLGDRITAIEEGKTPIGPHAAPGSDADGGPLPPALPGSPPDLPAPPSPSEIGSADGSL
PAPPVPPSAPPAPPAPPVEKVVGAIGQATTPVVPKDAAGGSADSKKKNRTIYLPPGFMKA
RLLTGIDALASRDATSNPEPIIARVQAPAVLPNDVKANLSGCFVIGNATGSLAKERVEIQ
LVSLSCVDFDEHSVVDQPVKGFFVDADGKKGLSGKVVTRAGAALARTFIAGTISGIAQTV
ENTFGDTSTSALGTVRTLDAGDAAKSGIAGGLSKSSDKLTDFYLDLARQAGPIVEVGAAK
DVVVVIQEGVTLEIKPTAGSKF
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgagcggcgaacgcgaagagatcgcgcccgaggatggcgcaccgatcgagcatagcccc
tatcagcaacgtcttgccgagcaggcatccctcgatcttgacgtaccgccgccaggttca
agctgggacgcggtgcgggcgcggtgggacggcctaagttcccgtcagaagctgcgggcc
aagcagttgggtgtcgcggccgccatcggcgtgctcggctatggcctctattcggcaagc
agttcggatacgcctgccgcgacggcgccggctgcatcgaagctcgacatgggcgccggc
ctgcgcggtgacagtctcgaagtcaaactgcgcggcgacctgaaaaaggtcctcgacggc
caaaatctgcttggcgaccgcatcaccgcgatcgaggaaggaaagacgccaatcggcccg
catgctgcccccggcagcgatgcggatggtgggccgctgccgccagcgctgcctggcagt
cctcccgatctgcccgcaccaccctccccgtctgagatcggcagtgccgatggcagcttg
cccgcaccgccggtgccaccatctgcgcccccggcgccccccgcgccgcctgtcgaaaaa
gtcgtaggcgcgatcggacaagcgacgacgcccgtcgttcccaaggacgccgcgggcgga
tcggcggactcgaaaaaaaagaatcggacgatctatttgccacctggtttcatgaaggcg
aggctgctgacggggatcgacgcactggcgagccgggacgcgacgtccaatccggaaccg
atcatcgctcgcgtccaggcgcccgccgtgctccccaatgacgtcaaggccaacctgtcg
ggctgcttcgtgatcggcaacgcgaccggcagtctcgcgaaagagcgcgtcgagatccag
ctcgtctcgctctcctgcgtcgacttcgatgagcattcggtggtcgaccagccagtgaag
ggctttttcgtcgacgcggatgggaagaagggtctgtcgggcaaggtcgtgacccgcgcc
ggcgcggcgctggcccgcaccttcattgccggcacgatcagcggaatcgcgcagacggtc
gaaaacaccttcggcgacacgtccacctcggcacttgggacggtgcgcacgctcgacgcc
ggcgatgccgccaagtcgggcattgccggcgggctctccaagtcctcggacaagctcacc
gacttctatctcgacctcgcgcggcaggccggacccatcgtcgaggtcggcgccgcgaag
gacgtggtcgtcgtcatccaggagggcgtgaccctcgagatcaagccaaccgcggggagc
aaattctga

DBGET integrated database retrieval system