KEGG   Sphingobium indicum UT26S: SJA_P1-01070
Entry
SJA_P1-01070      CDS       T01201                                 
Name
(GenBank) putative exported protein
  KO
K12064  conjugal transfer pilus assembly protein TraV
Organism
sjp  Sphingobium indicum UT26S
Brite
KEGG Orthology (KO) [BR:sjp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sjp02044]
    SJA_P1-01070
Secretion system [BR:sjp02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   SJA_P1-01070
SSDB
Motif
Pfam: TraV
Other DBs
NCBI-ProteinID: BAI99059
NITE: SJA_P1-01070
UniProt: D4Z8X7
Position
pCHQ1:82708..83343
AA seq 211 aa
MRVQSVICQPTFPNGRLALLPALALLSSCATVGSLMSPYSEKFSCKNSDHGQCIHPEKAY
EDAVAGRASRSDPTVTADRKLLKSGAADGAVPSAPVGGRTARQQAPAPGAFAGYRDSVYR
ELQGLIDDPVTPMLKSPRTVRTLILPYADRQRPDRLYMPRYVYSILEAPSWVVGDYLVNP
VSPAAQAPVLGQVRDKPSDDGAPASSPEPRP
NT seq 636 nt   +upstreamnt  +downstreamnt
atgcgcgttcaatctgtcatctgtcagccgacgtttccgaacggtcgcctggctctcctc
cccgccctcgcgctgctctcgtcctgcgcgacagtcggttcgctgatgtcgccctattcg
gagaagttcagctgcaagaacagcgaccatggtcaatgcatccatcccgagaaagcgtat
gaagatgcggtcgcgggacgggcgtcgcgctcggatcccaccgtcaccgccgatcgcaag
ctgcttaagagcggcgcggcggacggcgcggttccatctgcgcccgtcggcggccgcacg
gcgcggcaacaggcgccggcaccaggtgccttcgccggctaccgggacagcgtctatcgc
gagcttcagggcctgatcgatgatccggtgacgccgatgctcaaatcgccgcgtacggtg
cggactctgatcctgccctatgctgaccgccaacggcccgaccggctgtacatgccgcgc
tacgtctattcgatcctcgaggcgccaagctgggtcgtgggcgactatttggtcaatccg
gtatcgccggcagcgcaggcgcctgtgctcggtcaggtccgcgacaagccgtcagacgac
ggcgcccctgcctcgtccccggagccgcggccgtga

DBGET integrated database retrieval system