KEGG   Sphingobium indicum UT26S: SJA_P1-01110
Entry
SJA_P1-01110      CDS       T01201                                 
Symbol
traW
Name
(GenBank) plasmid transfer protein TraW
  KO
K12061  conjugal transfer pilus assembly protein TraW
Organism
sjp  Sphingobium indicum UT26S
Brite
KEGG Orthology (KO) [BR:sjp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sjp02044]
    SJA_P1-01110 (traW)
Secretion system [BR:sjp02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   SJA_P1-01110 (traW)
SSDB
Other DBs
NCBI-ProteinID: BAI99063
NITE: SJA_P1-01110
UniProt: D4Z8Y1
Position
pCHQ1:86420..87079
AA seq 219 aa
MSADPPILSARIAWFQAGTVAILLIASIFVAGAAHGETSTIGRTWPIAEPDALAEIEAKA
ATLPMDFGAKFGPRSRWSAMKSASLAPATAARVRTLVPFYTLDMDVTLPDGRVLYPKGFT
FNPLTYVSLPQRLVIVHARELGWALKTAAPTDWILLAAGGGTSADPIALGEKVGRPLFIL
EERVKDRLGLTVAPVIVRQVGQKLELTEVRLAQTGSAAR
NT seq 660 nt   +upstreamnt  +downstreamnt
atgtccgctgatcctcctatcctgtctgcgcgcatcgcctggtttcaggcaggcaccgtc
gctatcctgctgatcgcgtccatctttgtcgcgggcgcggcgcatggcgagacatctacg
atcgggcgcacctggccgatcgcggaacctgatgcgctggccgagatcgaggcgaaggcc
gcgacattgcctatggactttggcgctaaattcgggcctcgctcgcgctggtcggcgatg
aaatcagcgagccttgcgcctgcgactgcagcgcgcgtgcgcaccctcgtgcccttctac
acgctcgacatggatgtaacgctgccggacggtcgcgtgctctatcccaagggcttcact
ttcaacccgctcacctatgtctcgctgccgcagcggctcgtgatcgtccatgcacgcgag
cttggctgggcactcaagactgcagcgccgaccgactggatactgctggccgctggcggc
ggcaccagcgccgatcccattgcgcttggcgaaaaggtcggacggccgctcttcatcctc
gaagagcgtgtgaaggaccgccttggcctcacggtcgcacccgtgatcgtccgccaggtc
gggcagaagcttgagttgaccgaagtccgattggcgcaaacggggagcgccgcgcgatga

DBGET integrated database retrieval system