KEGG   Sphingobium indicum UT26S: SJA_P1-01120
Entry
SJA_P1-01120      CDS       T01201                                 
Symbol
traU
Name
(GenBank) conjugal DNA transfer protein TraU
  KO
K12060  conjugal transfer pilus assembly protein TraU
Organism
sjp  Sphingobium indicum UT26S
Brite
KEGG Orthology (KO) [BR:sjp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sjp02044]
    SJA_P1-01120 (traU)
Secretion system [BR:sjp02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   SJA_P1-01120 (traU)
SSDB
Motif
Pfam: TraU TraW_N
Other DBs
NCBI-ProteinID: BAI99064
NITE: SJA_P1-01120
UniProt: D4Z8Y2
Position
pCHQ1:87076..88089
AA seq 337 aa
MTRLKRLFCAGAAAILTALLPSALAQASSCPAGAVFNPITKVRWTCIFPITIGGVRIGTF
DKLSKELDAQSSSKPLCACRKGATFWFGVKVSFWSPNRMIDVVTEPGCMMALGADLMPTH
GKLQGSQSSISDGTNTRKMFAQMHYYISPVWAMLDMFTDLPCLEDNGFDVALITEVLPTW
QSGTLGAIIQPEGILFGNPAAGLACMADSAAAAAGKVIDPLFWCMGSWGATYPIAGDIHF
DDSVEAWAGLAARGTFMMGRLGAATISSADGCSFKAAPIWTKSRYKYQLMEPVKGGSCVN
VGRPGALWSSMKHAPGKDNAQFMVFEKVICCAGISTP
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgacccgcctgaaacgcctcttctgcgctggcgctgcggccattttgaccgcactgctg
ccatccgcgctcgcacaggcctcatcctgccccgccggcgcggtgttcaacccgatcacc
aaggtccgctggacctgcatctttccgatcacgatcggcggcgtgcgcatcggcaccttc
gacaagctttcgaaggagctcgacgcgcagtcctcgtcgaagccgctttgcgcgtgccgc
aagggcgcgaccttctggtttggggtgaaagtaagcttctggtcgcccaaccgcatgatc
gacgtggtgaccgaaccgggctgcatgatggccttgggcgccgacctgatgccgacgcat
ggcaagctgcagggcagccagtcatcgatctctgacggcacgaacacgcgcaagatgttc
gcgcagatgcactactacatctctcccgtctgggcgatgctcgatatgttcaccgatctt
ccctgcctggaagataatggatttgacgtagctctgatcaccgaggtgctgccgacctgg
cagtcgggaaccttgggagcgataatccagccggagggcattctcttcgggaacccggct
gcgggcctggcctgcatggcggacagcgccgctgcggctgccggcaaggtcatcgatccg
cttttctggtgcatgggcagctggggcgccacctatccgatcgccggggacatccatttc
gatgactcggtcgaggcttgggcaggactcgccgcgcgcggcaccttcatgatggggagg
ctcggcgcagcaacgatcagctccgccgacggctgctcgttcaaggcggcgccgatctgg
accaagtcccgctacaaatatcagctgatggagccggtcaaaggcggctcctgcgtcaat
gtcggccgcccgggtgcgctctggtcttcgatgaaacacgcgcccggcaaggacaatgcc
caattcatggtcttcgaaaaggtgatctgctgcgcgggaatttccacgccatga

DBGET integrated database retrieval system