KEGG   Sphingobium indicum UT26S: SJA_P1-01150
Entry
SJA_P1-01150      CDS       T01201                                 
Symbol
traN
Name
(GenBank) mating pair stabilization protein TraN
  KO
K12058  conjugal transfer mating pair stabilization protein TraN
Organism
sjp  Sphingobium indicum UT26S
Brite
KEGG Orthology (KO) [BR:sjp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sjp02044]
    SJA_P1-01150 (traN)
Secretion system [BR:sjp02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   SJA_P1-01150 (traN)
SSDB
Motif
Pfam: TraN
Other DBs
NCBI-ProteinID: BAI99067
NITE: SJA_P1-01150
UniProt: D4Z8Y5
Position
pCHQ1:90346..91443
AA seq 365 aa
MKRPSLLRGALLGVSLAFAGGITGPVHAQQLCAVDLNGNGDAADPGETASCLGTASGGWQ
CPIQQVACTVAAPGVYACPLGDQYACEAPASGGAPTCSPNACIDGGANPIEDEPVVDDPG
VPADGEIDADGNCTANIEIFSGRAVRCRPPGLKTTFSNCCKDKGKIVKDGMGSSISSIGT
KIAIAKGVFTGMKAAYTAFKAGATASQAATSGANAIIAGIDPTSIAISLAVNFMIEVLLQ
GCDQQDMETGMLRGSGMCHEVGSYCSSKILGICVQKAKGHCCFNTKLGRIIQEQGRPQLK
SFNGIGWGTPKNPMCRGFTPEEFQALDFSKMDLSEYYSEIQARTAGEIQVDMKDKIDAYM
QTVGH
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgaagcggccttctctcctgcgcggcgcgctgctcggcgtatcgctggcctttgcgggt
ggcataaccggacctgtccatgcgcagcagctttgcgctgtcgatctcaatggcaatggt
gacgctgccgatccaggggagaccgcaagctgtctcggtaccgcgtcgggcggatggcag
tgcccgatccagcaagttgcctgcacggtggccgcgccaggtgtctatgcctgtccgctc
ggggaccaatatgcctgcgaggcgccggcatcaggcggcgcgccgacctgttcgcccaat
gcctgtatcgacggcggtgcgaacccgatcgaggatgaacccgtcgtcgatgatccaggt
gtgccggctgatggcgagatcgacgccgacggcaattgtacggccaatatcgagattttc
tcaggccgcgcggtccgctgccggccacccggtctcaaaaccaccttcagcaactgctgc
aaggacaagggaaagatcgtcaaggacggcatgggatcgtccatctcttcgatcgggacc
aagatcgccatcgcaaagggcgtgttcacgggtatgaaggcggcctacacggcattcaaa
gccggagcgacggcgagtcaggccgccacgtcgggcgccaatgcgatcatagcgggtatc
gatcccacctcaatcgcaatcagcctggcggtaaatttcatgatcgaagtgctgctccag
ggctgtgaccagcaggacatggagaccggcatgctgcgcggctcgggcatgtgccatgag
gtcggcagctactgctcatcgaagatcctcggcatctgcgtgcagaaggccaagggtcat
tgctgcttcaacaccaagctcggccggatcatccaggagcaggggcggccgcagctcaaa
tcgtttaatggcatcggttggggcacccccaagaatccgatgtgtcgtggtttcacgccg
gaggagttccaggcgctcgatttcagcaagatggacctctccgaatattattccgagatc
caagcccgcaccgccggtgagatccaggtcgacatgaaggacaagatcgatgcctacatg
cagacggtcggccactga

DBGET integrated database retrieval system