KEGG   Sphingobium indicum UT26S: SJA_P1-01220
Entry
SJA_P1-01220      CDS       T01201                                 
Symbol
traH
Name
(GenBank) sex pilus assembly protein TraH
  KO
K12072  conjugative transfer pilus assembly protein TraH
Organism
sjp  Sphingobium indicum UT26S
Brite
KEGG Orthology (KO) [BR:sjp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sjp02044]
    SJA_P1-01220 (traH)
Secretion system [BR:sjp02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   SJA_P1-01220 (traH)
SSDB
Motif
Pfam: TraH
Other DBs
NCBI-ProteinID: BAI99074
NITE: SJA_P1-01220
UniProt: D4Z8Z2
Position
pCHQ1:95362..96741
AA seq 459 aa
MVAACGTTVPAHAQSWAESWFDNVTYTSPGSFEDQTRGYLTAGGMSGRVDVHNDYLMSLS
LPKVKAGCGGIDMFLGGMSFLDPDYLVQKLESILQAAPAVAFQYLLETLDEKMGNIISKM
EAATNFLNSIQVNDCRLANRMVQIAKGDDNMSGIIEEMTGYRSVKQGFAKSYQQSREKIQ
ANNNNPTEDLKDALENCPAEVTDIFRTGSLLSHAASRVGAADWAEVMRARVGDVYMRWDP
NDKVPLFSAIPACPRQDTESPDDFLSGRVQRRVLNIPATGADCSNDGGKGALELARTRMD
SIATKIRTRAALTAEERQFVANVSTLPVYRMLEWGVRQGVAGSVIGDTDELVALTLAYQM
LNDLTRSIDFALSNAERGTTAAGAADAANTSICQTRILTKGIEQLRDLREEVLRQRAQMR
QSYLAALGAANLSANYAGLMRQRDRDARDAAGAAAAREQ
NT seq 1380 nt   +upstreamnt  +downstreamnt
gtggttgccgcgtgcggcacaaccgtccccgcgcatgcccagagctgggccgagagctgg
ttcgacaatgtcacctataccagcccgggaagcttcgaggatcaaacccggggctatctg
accgccggcgggatgtcgggacgcgtcgacgtgcacaacgactatctcatgtcgctgagc
ctgcccaaggtgaaggcagggtgcggcggcatcgacatgttccttggcggcatgagcttc
ctggacccggactatctcgtccagaagctggagagcatcctgcaggcagcgcctgcggtc
gcattccagtacctcctcgaaacgctcgacgagaagatgggcaacatcatttcgaagatg
gaggcggccaccaatttcctgaactcgatccaggtcaacgactgccgcctcgccaaccgt
atggtccagatcgccaagggcgacgacaatatgtccgggatcatcgaggagatgactgga
taccgttccgtcaagcaaggcttcgccaagagctatcaacagagccgcgagaagatccag
gccaacaacaacaacccgaccgaagatctgaaggacgcgctggagaactgcccggcggag
gtcaccgacatcttccgtaccggctctctgctctctcacgcggcctcgcgcgtcggcgcg
gccgactgggccgaggtcatgcgggcgcgggtgggcgacgtctatatgcggtgggatccg
aacgacaaggttccgctcttctcggcgatccccgcctgcccgcgccaggacaccgaatcc
ccggatgatttcctgagcggccgcgttcagcgccgcgtgctcaacatcccggcaaccggc
gccgactgctcaaacgatggaggcaagggcgccctggagctggcgcgcacgcgcatggat
tcgattgcaaccaagattcgaacgcgcgcggcgctcacagccgaggaacgacagttcgta
gccaatgtcagcacgctgcccgtctaccgtatgctcgaatggggcgtccgtcagggcgtg
gcaggctcggtaatcggcgataccgacgaattggtcgcgctcacccttgcctatcagatg
ctgaatgacctcacacggtcaatcgactttgcgctgagcaatgccgagcgcggcacaacg
gctgcgggcgcggccgatgctgccaacaccagcatttgccagactcgcatcctgaccaag
gggatcgagcagctgcgcgatctccgagaagaagttctgcgccagcgcgcgcagatgcga
caatcgtacctggcggcgttgggagccgcgaacctgtccgccaattatgcgggcttgatg
agacagcgcgatcgcgatgcccgcgacgctgccggcgccgccgccgcacgggagcagtga

DBGET integrated database retrieval system