KEGG   Sphingobium indicum UT26S: SJA_P1-01230
Entry
SJA_P1-01230      CDS       T01201                                 
Symbol
traG
Name
(GenBank) DNA transfer and F pilus assembly protein TraG
  KO
K12056  conjugal transfer mating pair stabilization protein TraG
Organism
sjp  Sphingobium indicum UT26S
Brite
KEGG Orthology (KO) [BR:sjp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sjp02044]
    SJA_P1-01230 (traG)
Secretion system [BR:sjp02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   SJA_P1-01230 (traG)
SSDB
Motif
Pfam: TraG_N
Other DBs
NCBI-ProteinID: BAI99075
NITE: SJA_P1-01230
UniProt: D4Z8Z3
Position
pCHQ1:96746..100474
AA seq 1242 aa
MIRRLIRVALALAMVGAATPAFAIDASFYTYDGFAETVDAFRLVAMIFADPRYETLVIVI
ATVGISLGALLASVRGQGMGLVAFGFQMLIGIGLFVGMIATTGTVHVYDKVRNAYQPVGD
VPNLLVLVAGTTNLIERALVETIDDNTLDPNIKIEFGAGGHTFDLFFNAVSPRGPITDTF
LDATIKDYVRQCYPVARVSAAYGVDDDRLFRTATDLPAAFAAMAGPATFSTVYTAADKGG
TTVSCDEAWQHISTALSDPALFDDYSRQVCTRTGFDVTQPDQLNRCRSQLGEMGDMMMGT
PLSLQAFMTNILLGNSVGDVLFEDSPASAARVMANRAVISNGLATMSVANEWMPTIRAVV
FGIMLFMIPIALLFILTPINLRVASFALGLFVFVALWGVIDAGIYQLTLGRAMDALAEMR
SNAVATNAWLLAPSAAQKALAIFGSFRTAAAGLAGAFVFTVFRFSGNVFTSFTSGSLGVH
GQASAAAAPLATGEGYASALEAQASATGTMARRNASSNFGDFGERSTFGANRSFGAAGGL
LSERASGVPGVPAFGMGGIDAARELGGLTPALVNGDLSNPAVQRAVRANATTAAIHQFAE
KDALRSLGNRYFGEGQAGERAFASFAQNMVQWRAFGDQRAYDMMLQGATRHFSRNGYGAD
DAQLKAASVISEASADPTFAKLIANTFDQEAMLQNDLTSAQVQVGAMEGRRDYAGDRVAQ
VERGNVATEQAHRTGSNEGQRNAAAMLGLSVDETSRRISFINALSGEARSSAISQLSRAT
GRNEAQVMHALESYNAAVHVGTADGATAEAAREGTSVYGRTREAAGYDFAERAGKLDAQR
EVGHDGTRNAARIGEQRRQSENFGFAEGAEAAGVSTREAARLDSFIQTLSRTAGNQVDMA
EGGSAGVADRARNERLTRIVDNERLTRAQGLLRSHGIDLTKRQIAMDQNGDFSLNLTPET
AAQMWRAGLINQDQLGAVANGGSARFSFAHNDLLISSSTGFQRSARSDTSTRFEAGKQAG
PDTIEHFLGSGTEGQAAMANWLKGGFEMDRSGNWRLKPQVADTLERDVTAIMVQTGWQRS
LSRGASHQVTNGDAESIGISGGVGGRGSQTAKGKAGQASGNEGGSTASINLQTSDLGVGS
TDARSSIDIVNHDVRNAIANAERAASRSRTPEAAFSSELGRAILGADGLRNRYLDQADAG
RGPWDATAPFTSIEQSQILRSGRFTGDRTNGLEDGDPEFKRR
NT seq 3729 nt   +upstreamnt  +downstreamnt
atgatccgccgccttatccgcgtcgcgcttgccctcgcaatggtgggcgccgcaacgccc
gctttcgcgatcgacgccagcttctatacctatgacgggtttgccgagacggtcgatgcc
tttcgcctcgtcgcaatgatcttcgctgatccgcgctacgagacgctcgtgatcgtgatc
gcgaccgtcggcatctcgctcggcgcgctgctggcgagcgttcgcggacaagggatgggt
ctcgtcgccttcggtttccagatgctgatcgggatcggcctgttcgtcggcatgatcgcc
accactgggaccgtccacgtctacgacaaggtccgcaacgcctatcagccggtcggtgac
gttcccaatctgctggtgttggtggccggcaccactaaccttatcgagcgcgcgttggtc
gagacgatcgacgacaatacgctcgatcccaacatcaagatcgagtttggtgcaggcgga
cacacgttcgacctcttcttcaatgccgtatctccgcgcggcccaattaccgacaccttt
ctcgacgcgacgatcaaggattatgtgcggcaatgctatcccgtggcccgggtctccgca
gcctatggcgtcgatgatgataggctgttccgaactgccaccgatctgcctgcggcgttc
gcagcaatggccggaccagcgacattctcaaccgtctatacggccgccgacaagggcgga
acgacggtgagctgcgacgaggcatggcagcatatctcgacagccctttcggaccccgcg
ctgttcgacgactacagccggcaggtctgcacacggaccggcttcgatgtgacccagccc
gaccagctcaatcgctgccggagccagctgggcgaaatgggcgacatgatgatgggcact
ccgctctctctccaggcgttcatgaccaatatcctgctcggcaacagcgtcggcgacgtt
ctcttcgaggatagtccggcttctgcggccagggtcatggccaatcgtgccgtgatatcg
aacggccttgccaccatgtcagtggcgaacgaatggatgccaaccatccgtgccgtcgtg
ttcgggatcatgttgttcatgatcccgatcgcgctgctcttcatcctgacgccgatcaac
ctccgcgtggccagcttcgcgctcggcctgttcgtgttcgtggcgctctggggtgtgatc
gacgccggcatctatcagctgacactgggccgcgcgatggatgcgctcgccgagatgcgc
tcgaatgcggtggcgaccaatgcgtggctcctggcgccgtcggcagcgcaaaaggcgctc
gccatcttcggcagcttcaggacagcagcggcgggtctcgccggtgcctttgtcttcacg
gtgttccgtttctccgggaatgtcttcacatccttcaccagcggatctctcggcgtacat
ggccaggcgagcgccgcggcagcaccgctcgccaccggcgaaggctatgcctcagccctc
gaggcgcaggcgtccgcaacgggcacgatggcgcgccggaacgcctcgtcgaacttcgga
gatttcggcgagcgctcgacgttcggagcaaatcgaagctttggcgcagccggcggtctg
ctcagcgagcgggcatccggcgttccgggcgttcctgcgtttggaatgggcggcatcgat
gccgcccgggaattgggcggcctgacccctgccctcgtcaacggcgatctctcgaacccg
gccgttcaacgcgccgtgcgcgcgaacgcgacgacggccgccatccatcagttcgcggag
aaagacgcgctcagatctctcgggaatcgatatttcggagagggccaggcgggcgagcgc
gcttttgcatcattcgcgcagaatatggtgcaatggcgggcgttcggcgaccagcgtgca
tacgacatgatgctgcagggcgcgacacggcacttttcccgcaacggttatggcgcggac
gatgcgcagctaaaggcggctagcgtcatcagtgaggcatcggctgatccgacgttcgcc
aagcttatcgccaataccttcgatcaggaggcgatgctgcaaaatgacctcacgtcagcg
caggtgcaggtaggcgcgatggaggggcggcgggactatgcgggcgaccgggtcgcgcag
gttgagcgcggcaatgtggctaccgagcaggcgcaccgaaccggcagcaatgaaggtcag
cgcaacgcagcggccatgctcggcctctcggtcgacgaaaccagccggcgcatctccttc
atcaatgcgctgtcgggtgaagcgcgctcgtccgccatcagccaactctcccgcgcaacg
ggtcgcaatgaggctcaggtgatgcacgcgctggagagctacaatgcggcggtccatgtc
ggaaccgcggacggcgctacagccgaggcggcgcgtgaaggaaccagcgtctacggtcgg
acacgcgaagcggccggctatgattttgcggagcgcgccggcaagctcgatgcacagcgc
gaagttggtcacgatggaacgcgcaacgcggcgcggatcggcgagcaacgtcggcagtcg
gagaatttcgggttcgccgagggagctgaagcggcaggtgtctcaacacgcgaggccgct
cggctcgacagcttcatccaaacgctgtcgagaactgccggcaaccaggtcgacatggcg
gaaggcggatctgccggcgtcgccgatcgcgctcggaacgagcggcttacccgcatcgtg
gacaatgagcgccttacaagggctcaaggattgctgcggagtcatggtatcgatctgacg
aagcgccagatcgcgatggatcaaaatggagactttagcctcaatctgacaccggaaact
gcagcgcagatgtggcgggccgggctgatcaaccaggaccagcttggcgcggtcgccaat
ggcggcagcgcgcggttcagctttgctcacaatgatctgctcatctcgagcagtacgggc
ttccagcggtcggcgcggagcgataccagcacacggttcgaggccggcaagcaagcggga
cccgatacgatcgaacattttctcggtagtggcacggaaggccaggcggcgatggcgaat
tggctcaagggcgggttcgagatggatcgcagcggcaactggcggctcaaaccacaggtt
gccgacacgttggaacgcgatgtaacggcgatcatggttcaaactggttggcaacgctcc
ttgtctcgcggtgcctcccatcaagttacgaatggcgatgccgaaagcatcggaattagt
ggcggagttgggggacgcggtagccaaaccgccaaaggaaaagcagggcaagcatctggg
aacgaaggtggatctaccgctagtatcaatttgcaaacatccgacttaggcgtcggctcg
acagatgcgcgttcgtccattgatatcgtgaatcatgacgtacgcaacgctatcgcaaat
gctgaacgagctgcctcaaggtcccgcacaccggaggcggcattcagtagcgagctgggt
cgcgcgatcctcggtgctgacggcctccgaaatcgttatttggatcaagcggatgcgggg
cgtggcccttgggacgcgacagcgccattcacatcgattgaacaaagccaaatcttgcga
agcgggcgcttcactggcgatcgaaccaatggcctggaagacggcgatcctgaatttaag
cgccgttag

DBGET integrated database retrieval system