KEGG   Sphingobium japonicum: SJA_P1-01720Help
Entry
SJA_P1-01720      CDS       T01201                                 

Gene name
trbL
Definition
(GenBank) conjugal transfer protein TrbL
  KO
K07344  type IV secretion system protein TrbL
Organism
sjp  Sphingobium japonicum
Pathway
sjp02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sjp00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SJA_P1-01720 (trbL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sjp02044]
    SJA_P1-01720 (trbL)
Secretion system [BR:sjp02044]
 Type IV secretion system
  Trb secretion system protein
   SJA_P1-01720 (trbL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbL Glyco_transf_7C
Motif
Other DBs
NCBI-ProteinID: BAI99124
NITE: SJA_P1-01720
UniProt: D4Z942
Position
pCHQ1:complement(140928..142286)
Genome map
AA seq 452 aa AA seqDB search
MGNTGVIDHFLEVFTRYIDGGFGLLGGEVTFIATTLIVIDVTLAALFWSWGADDDIIARL
VKKTLFVGVFAYIIGNWNNLARIIFESFAGLGLKASGTSFTTADLLRPGKVAQTGLDAGR
PLLDSISGLMGYWSFFENFIQIACMFLAWALVLLAFFILAIQLFVTLIEFKLTTLAGFVL
IPFGLFGKSAFMAERVLGNLISSGIKVLVLAVIIGIGSTLFSEFTAGFGGATPSVDEAMA
IVLAALSLLGLGIFGPGIASGIVSGGPQLSAGAAVGTGLAAGGMVALGAGAVGAAATGGA
SLAGGAAAAARGGAALAGGASTAYSLGAAGQTGAASVAAGLGGVARAGGSAAISPLRRAA
SRAAEGMRSSFNAGGRAVLGATGGSTTGGPSAGGPGSEDAAATAGGGGPPAWAQRMRRRQ
QMSHAVQATAHAVRSGDAHGGGSSVNLSEGDR
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggggaacaccggcgtcatcgaccatttcctcgaggtcttcacccgttacatcgacggc
ggcttcggtctgctcggcggcgaggtgacgttcatcgccacgacgctgattgtgatcgac
gtgacgctcgcggcgctcttctggtcctggggcgccgatgacgacatcatcgcccgactg
gtgaagaagacgctgttcgtcggcgttttcgcctacatcatcggcaactggaacaacctc
gcccggatcatcttcgagagcttcgccggtctcggcctgaaggcgagcggcaccagcttc
accacggccgatcttcttcgccccggcaaggtcgcgcagaccgggctcgatgcgggacgg
ccgctgctcgattcgatctccgggctgatgggctattggagcttcttcgagaacttcatc
cagatcgcctgcatgttcctcgcctgggcgctggtgctgctcgccttcttcatcctcgcc
atccagctcttcgtcaccctgatcgagttcaagctgacgacgctcgccggcttcgtgctg
atccccttcggcctgttcggaaagtccgccttcatggccgaacgggtgctcggcaacctc
atctcgtccggcatcaaggtcctcgtcctcgcggtcatcatcgggatcggatcgaccctg
ttctccgaattcacggcgggcttcgggggcgccacgccatcggtcgacgaggcgatggcc
atcgtcctcgcagccctctcattgctcggccttggcatcttcgggcccggcatcgcgtcc
ggcatcgtctcgggcggtccgcagctcagcgccggcgctgccgtcggcacgggtctcgcc
gccggcggcatggtcgcgctcggagccggcgccgtgggcgccgccgcgacaggcggcgcc
tccctggcaggcggggccgccgccgccgcccgcggtggcgctgccctcgctggcggcgca
tcgaccgcctacagcctcggggccgcggggcagacgggcgctgctagcgtcgccgccggt
ctgggcggcgtcgcccgggccggcgggagtgccgcgatctcgccccttcgtcgcgccgcc
tcccgcgccgctgaaggcatgcgctcgagcttcaatgccggcggccgcgcggttcttgga
gccacgggcggctccacgaccggtggaccgagcgccggcggaccggggtccgaagatgcg
gctgctacggcaggcggcggaggcccacccgcctgggcgcagcgcatgcgccgccgccag
caaatgtcccatgccgtccaggcgacggcccatgccgtccgctcgggtgatgcccatggc
ggcggctcctccgtcaacctgtccgaaggcgaccgctga

DBGET integrated database retrieval system