KEGG   Streptomyces kanamyceticus: CP970_39765
Entry
CP970_39765       CDS       T06849                                 

Definition
(GenBank) ester cyclase
  KO
K15945  C-1 hydroxylase
Organism
ska  Streptomyces kanamyceticus
Pathway
ska01057  Biosynthesis of type II polyketide products
ska01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ska00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    CP970_39765
SSDB
Motif
Pfam: SnoaL SnoaL_2 DUF4440 PHZA_PHZB
Other DBs
NCBI-ProteinID: QEU97855
UniProt: A0A5J6GVA4
Position
9151310..9151729
AA seq 139 aa
MSPADNKRRALDMVAAWNRGEPDGVIAYWAPDAVHYDEDGGPMPAEQIADIMRGSLNSFP
DLHLEAKSIVAEDDRVMLRITVTATHAGDFMGVPATGKPVTWHYLEELRFNERGQVVEHW
DVMNFSPLFRALGSVPDGL
NT seq 420 nt   +upstreamnt  +downstreamnt
gtgtcacccgccgacaacaagcgccgtgccctggacatggtcgccgcctggaaccgaggc
gaacccgacggtgtcatcgcctactgggcacccgacgcggtccactacgacgaggacggc
gggcccatgcccgccgaacagatcgccgacatcatgcggggctccctgaactccttcccc
gacctccacctggaggcgaagagcatcgtcgccgaggacgaccgcgtgatgctccggatc
accgtcaccgccacccacgcgggcgacttcatgggcgtacccgccaccgggaaaccggtc
acctggcactacctggaggagctgcgcttcaacgagcggggccaggtcgtcgagcactgg
gacgtcatgaacttctcgcccctcttccgcgcgctggggagcgtccccgacggcctctga

DBGET integrated database retrieval system