KEGG   Sanguibacter keddieii: Sked_00680Help
Entry
Sked_00680        CDS       T01214                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ske  Sanguibacter keddieii
Pathway
ske00010  Glycolysis / Gluconeogenesis
ske00052  Galactose metabolism
ske00500  Starch and sucrose metabolism
ske00520  Amino sugar and nucleotide sugar metabolism
ske00521  Streptomycin biosynthesis
ske01100  Metabolic pathways
ske01110  Biosynthesis of secondary metabolites
ske01120  Microbial metabolism in diverse environments
ske01130  Biosynthesis of antibiotics
ske01200  Carbon metabolism
Module
ske_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ske_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sked_00680
   00052 Galactose metabolism
    Sked_00680
   00500 Starch and sucrose metabolism
    Sked_00680
   00520 Amino sugar and nucleotide sugar metabolism
    Sked_00680
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sked_00680
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Sked_00680
Enzymes [BR:ske01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sked_00680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase HTH_AsnC-type
Motif
Other DBs
NCBI-ProteinID: ACZ20041
UniProt: D1BI67
Position
69227..70159
Genome map
AA seq 310 aa AA seqDB search
MSDRLVLALDIGGTNARGEVLDVRLGAPLVRADLPTPEQDGEATIATIESLCRLLLAGLS
ETDRARVQAVGLAVPGIIDAETGVVRLASNLGWSDEPVAARLSALLGLEVVLHHDVTAAG
LAEHRLGAGAGAPDLLAVFIGTGMAALVVTGGEVVSGGLHQAGEIGHMPVEQGGRPCPCG
QTGCLEMYASARAIGRAYGAVTGDVSATSLDVVTALGTDPRADAVWSEAMDWLAHGLLGP
ITLLSPVRIVLGGGLSASGAVLVDALRTRLDALSHVAAVPEIVTASLGQRAGVLGSGLAT
FAAIERTQLV
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaccgcctggtcctcgcgctcgacatcggggggaccaacgcccggggcgaggtg
ctcgacgtgcgcctcggcgcacccctggtccgcgccgacctgcccacccccgagcaggac
ggcgaggccaccatcgcgaccatcgagtcgctgtgccggctgctgctcgccgggctctcc
gagaccgaccgcgcccgggtgcaggccgtcgggctcgccgtgcccgggatcatcgacgcc
gagaccggcgtggtgcgcctcgcgagcaacctcgggtggtcggacgagcccgtggccgcg
aggctgtccgcgctgctcgggctcgaggtcgtgctgcaccacgacgtcacggccgccggg
ctcgccgagcaccgcctcggtgccggcgcgggcgcgcccgacctgctcgccgtgttcatc
gggaccgggatggcggcgctcgtcgtcaccggcggcgaggtggtgtccggcggcctgcac
caggccggcgagatcgggcacatgcccgtcgagcagggcgggcgcccgtgcccgtgcggg
cagacggggtgcctcgagatgtacgcctcggcgcgagccatcggccgtgcctacggcgcg
gtcaccggggacgtctcggcgacctccctcgacgtggtcacggctctcggcacggacccc
cgggccgacgccgtgtggtccgaggccatggactggctcgcccacgggctcctcggcccc
atcacgctgctctcgcccgtgcgcatcgtgctcggcggagggctgtccgcgtccggcgcc
gtcctcgtcgacgcgctgcgcacccggctcgacgcgctgtcccacgtggccgcggtcccc
gagatcgtcaccgcgtcgctcgggcagcgggccggcgtgctcgggtcggggctcgcgacc
ttcgcggcgatcgagcgcacccagctggtgtga

DBGET integrated database retrieval system