KEGG   Sanguibacter keddieii: Sked_01910Help
Entry
Sked_01910        CDS       T01214                                 

Definition
(GenBank) alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
ske  Sanguibacter keddieii
Pathway
ske00052  Galactose metabolism
ske00561  Glycerolipid metabolism
ske00600  Sphingolipid metabolism
ske01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Sked_01910
  Lipid metabolism
   00561 Glycerolipid metabolism
    Sked_01910
   00600 Sphingolipid metabolism
    Sked_01910
Enzymes [BR:ske01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Sked_01910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_31
Motif
Other DBs
NCBI-ProteinID: ACZ20162
UniProt: D1BIX0
Position
200671..202188
Genome map
AA seq 505 aa AA seqDB search
MSIQSPPRLPLTLHGGEVGGSPTWASAPTGADAPTETFFTASRAAFLHGRTEGDVYRNGH
NSWSPSGWRAIADAPLRVANPVRRQTADDTRWDDPARHHSSWMIAVASEQGTLLLGCLDG
ETPRLHADTDLVSAWTETGRSASWVLLEGDELAVFARYRDLLVERHGSLSQAPGAVWSSW
YSYYETISRADLDEVVPQLPGLGFDTVQVDDGWERLVGDWHPNDKFSAGMKDTVSLISDH
GMRAGLWIAPFITLPDAEVVQKNPQMLLRDASGSLVHAGTNWGSHYYTFDFTRPDAQGFL
VDTVSRAVHDWGFSYLKLDFINAGTVDGVRSQDVDREQAYRTAIETIRAAVGPDTYLLGS
GAPIFSSLGVLNAVRTGPDVAPMWDNYATDDPSDATAHNALSNAVSRLWMRGLVGLDPDV
VYFRHRRNLLSDQQMQWLKDCATLSGFPAVSDPPAWIDAEDHDELRTFLTTSPATEQVGR
YRFRIEDREVDFGPVFDDSDSFYPL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatccagagccctccccgtctccctctcaccctccacgggggtgaggtgggcggc
agcccgacctgggcgagcgcaccgaccggtgcggacgccccgaccgagaccttcttcacc
gcctcccgggcggcgttcctgcacggccgcaccgagggcgacgtgtaccgcaacgggcac
aactcctggtctccgtccgggtggcgcgcgatcgccgacgcgcccctgcgcgtcgccaac
cccgtccgccgccagacagccgacgacacccgctgggacgaccccgcccggcaccactcg
tcctggatgatcgccgtggcgtccgagcagggcaccctgctgctcggctgcctcgacggc
gagaccccgcgcctgcacgccgacaccgacctcgtcagcgcctggaccgagaccggcagg
tcggcgtcctgggtgctcctcgagggcgacgagctcgccgtcttcgcgcggtaccgcgac
ctcctcgtcgagcgccacggcagcctctcgcaggcacccggcgccgtctggtcctcctgg
tactcctactacgagaccatctcgcgcgcggacctcgacgaggtcgtgccccagctcccg
ggcctcggcttcgacaccgtgcaggtggacgacggctgggagcgcctggtcggcgactgg
cacccgaacgacaagttctccgccggcatgaaggacaccgtcagcctcatcagcgaccac
ggcatgcgggcagggctgtggatcgcgccgttcatcacgctcccggacgccgaggtggtg
cagaagaacccgcagatgctgctgcgggacgcgtcgggctccctggtccacgccggcacc
aactggggcagccactactacaccttcgacttcacgcgtcccgacgcccagggcttcctc
gtcgacaccgtgagccgcgcggtccacgactggggcttcagctacctcaagctcgacttc
atcaacgccgggaccgtcgatggcgtgcggtcccaggacgtcgaccgcgagcaggcgtac
cgcacggcgatcgagacgatccgcgccgcggtcggtcccgacacctacctcctgggctcc
ggggcgcccatcttctcgtcgttgggcgtgctcaacgccgtgcggaccggcccggacgtc
gcgcccatgtgggacaactacgcgacggacgacccgtcggacgccaccgcccacaacgcc
ctctccaacgcggtgagccgcctgtggatgcgcggcctcgtcggcctggacccggacgtc
gtgtacttccggcaccgcaggaacctgctgagcgaccagcagatgcagtggctcaaggac
tgcgcgacgctctcgggcttccccgcggtgtccgacccgcccgcgtggatcgacgccgag
gaccacgacgagctgcgcacgttcctcaccacgtcgccggcgaccgagcaggtaggacgg
tacaggttccgcatcgaggaccgcgaggtcgacttcggcccggtgttcgacgactcggac
agcttctacccgctgtga

DBGET integrated database retrieval system