KEGG   Sanguibacter keddieii: Sked_08230Help
Entry
Sked_08230        CDS       T01214                                 

Definition
(GenBank) mycothiol conjugate amidase Mca
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
ske  Sanguibacter keddieii
Brite
KEGG Orthology (KO) [BR:ske00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Sked_08230
Enzymes [BR:ske01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     Sked_08230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: ACZ20774
UniProt: D1BBZ4
Position
933505..934392
Genome map
AA seq 295 aa AA seqDB search
MTTAPLRLLAVHAHPDDESSKGAATTARYAAEGVEVLVVSCTGGERGSILNPSYGRDITD
LDEMRSVRTVEMAEAARALGVQHRWLGFVDSGLPEGDPLPPLPEGCFALTPLEDAAAPLV
EIVREFRPHVITTYDPTGGYPHPDHIMCHRVAKEAYETAGDAERYRGRGEPWTPLKLYYN
HGFSMARIRAVHEAMLGAGLESPFGDWVESRAAREIPEREVTTRVPVADYFDARDAALRA
HATQIDPDGFFFAVPRDLELDEWPFEEYELAESRVATTLPEDDLFAGIRPPEETA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacagcaccgttgcggctcttggccgtgcatgctcaccccgacgacgagtcgagc
aagggagcggccacgacggcgcgctacgccgcggagggcgtcgaggtgctggtggtcagc
tgcaccggcggggagcgggggagcatcctcaaccccagctacggccgtgacatcaccgac
ctcgacgagatgcgctccgtgcgcaccgtcgagatggccgaggccgcccgtgcgctgggc
gtccagcaccgctggctcggttttgtcgactcgggcctgcccgagggcgacccgctgccg
ccgctgcccgagggctgcttcgcgctgaccccgctcgaggacgcggccgcgccgctcgtg
gagatcgtccgcgagttccgcccgcacgtcatcaccacctacgaccccaccggcgggtac
ccgcacccggaccacatcatgtgccaccgtgtcgccaaggaggcctacgagaccgctggc
gacgccgagcgctaccgcgggcgcggcgagccctggacgccgctcaagctgtactacaac
cacggcttctcgatggcccgcatccgcgcggtccacgaggcgatgctcggtgccggcctc
gagtcgcccttcggcgactgggtcgagtcccgcgcggcccgcgagatccccgagcgcgag
gtcaccacccgcgtgccggtggcggactacttcgacgcccgggacgccgctctccgtgcg
cacgccacgcagatcgaccccgacggtttcttcttcgccgtcccgcgcgacctcgagctc
gacgagtggcccttcgaggagtacgagctcgccgagtcgcgcgtcgccaccacgctcccc
gaggacgacctgttcgccgggatccgcccccccgaggagaccgcatga

DBGET integrated database retrieval system