KEGG   Sanguibacter keddieii: Sked_15220Help
Entry
Sked_15220        CDS       T01214                                 

Definition
(GenBank) Polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
ske  Sanguibacter keddieii
Pathway
ske00010  Glycolysis / Gluconeogenesis
ske00520  Amino sugar and nucleotide sugar metabolism
ske01100  Metabolic pathways
ske01110  Biosynthesis of secondary metabolites
ske01120  Microbial metabolism in diverse environments
ske01130  Biosynthesis of antibiotics
ske01200  Carbon metabolism
Module
ske_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ske_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sked_15220
   00520 Amino sugar and nucleotide sugar metabolism
    Sked_15220
Enzymes [BR:ske01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Sked_15220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ACZ21457
UniProt: D1BFU6
Position
complement(1704246..1705028)
Genome map
AA seq 260 aa AA seqDB search
MSHSKKSHSKHEVAFGIDVGGSGIKGAPVDLKTGEFAADRVRIPTPEGSTPEAVTAVIAE
LVESFDLHKKTPVGIAFPAPILHGVVPSIANLDQSWAGVNLDKIVSEALDRTVVGVNDAD
AAGVGEAVYGAARDKEGTILLSTLGTGIGSALLVDGHLLPNTELGHLEIDGHDAESRASD
RARTREDLSWEQWAERLQRYFETVEFLFSPDLIVVGGGVSKHHEKFLPLLDLRSPIIPAT
LRNAAGIVGAARLAADADAS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagccactcgaagaagagtcacagcaagcacgaggtcgccttcggcatcgacgtgggc
gggagcggcatcaagggcgccccggtcgacctgaagaccggtgagttcgcggccgaccgc
gtccgcatccccacccccgagggctcgacccccgaggccgtcaccgcggtgatcgccgag
ctggtcgagagcttcgacctgcacaagaagacgcccgtgggtatcgccttcccggcgccg
atcctgcacggcgtcgtgccgtcgatcgccaacctcgaccagtcgtgggccggcgtgaac
ctcgacaagatcgtgtcggaggcgctcgaccgcaccgtggtgggcgtcaacgacgccgac
gcggcgggtgtcggcgaggccgtctacggcgcggctcgggacaaggagggcaccatcctg
ctctcgaccctcggcaccggcatcggcagcgcgctcctcgtggacgggcacctgctgccg
aacaccgagctcggccacctcgagatcgacggacacgacgccgagtcccgcgcctcggac
cgtgcgcggacccgggaggacctgtcgtgggagcagtgggccgagcgcctgcagcgctac
ttcgagacggtcgagttcctcttctcccccgacctcatcgtggtcggcggtggtgtgagc
aagcaccacgagaagttcctgcccctgctcgacctgcgctcccccatcatcccggcgacg
ctgcgcaacgcggcggggatcgtcggcgcggcccggctggccgcggacgccgacgcgagc
tga

DBGET integrated database retrieval system