KEGG   Sanguibacter keddieii: Sked_18080Help
Entry
Sked_18080        CDS       T01214                                 

Definition
(GenBank) haloacid dehalogenase superfamily protein, subfamily IA, variant 3 with third motif having DD or ED
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
ske  Sanguibacter keddieii
Pathway
ske00361  Chlorocyclohexane and chlorobenzene degradation
ske00625  Chloroalkane and chloroalkene degradation
ske01100  Metabolic pathways
ske01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ske00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sked_18080
   00361 Chlorocyclohexane and chlorobenzene degradation
    Sked_18080
Enzymes [BR:ske01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     Sked_18080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: ACZ21735
UniProt: D1BH15
Position
2017067..2017702
Genome map
AA seq 211 aa AA seqDB search
MTGTAHDSATRPQVDTVLYDLGNVLVGWDPYGPFVGLDRAEVDRFFDETDFLAHNHEQDA
GRPWAELRALVAASWPQHAHLVDRYVDGFAASLTGPVPGSAEIVDELAASGARLYGLTNW
SAELFHHAVPAAPAIGRLEGIVVSGEVGLAKPAPEIFRLTVETFGLDPARTVFVDDSLPN
VRSAQDVGLHAVHFTTSAALRDELVALGLLG
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggcacggcgcacgacagcgcgacccgcccgcaggtggacaccgtcctctacgac
ctcggcaacgtcctcgtcggctgggacccctacggtcccttcgtcgggctcgaccgtgcg
gaggtcgacaggttcttcgacgagaccgacttcctggcgcacaaccacgagcaggacgcc
ggccggccctgggcggagctgcgggccctcgtcgcagcctcctggccgcagcacgcgcac
ctcgtcgaccgctacgtcgacggcttcgccgcgagcctcaccggaccggtccccgggtcg
gcggagatcgtcgacgagctcgccgcgtcgggggcgcggctctacggcctcaccaactgg
tcggccgagctgttccaccacgccgtcccggcagccccggcgatcgggcgcctcgagggc
atcgtcgtctcgggcgaggtcgggctggccaagcccgccccggagatcttccggctgacc
gtcgagaccttcggcctcgaccccgcccgcacggtcttcgtcgacgactcgctccccaac
gtgcgctccgcgcaggacgtcgggctgcatgccgtgcacttcaccacctccgcggcgctg
cgcgacgagctcgtcgcgctcggcctgctgggctga

DBGET integrated database retrieval system