KEGG   Sanguibacter keddieii: Sked_28160Help
Entry
Sked_28160        CDS       T01214                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ske  Sanguibacter keddieii
Pathway
ske00020  Citrate cycle (TCA cycle)
ske00640  Propanoate metabolism
ske00660  C5-Branched dibasic acid metabolism
ske01100  Metabolic pathways
ske01110  Biosynthesis of secondary metabolites
ske01120  Microbial metabolism in diverse environments
ske01130  Biosynthesis of antibiotics
ske01200  Carbon metabolism
Module
ske_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ske_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ske00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sked_28160
   00640 Propanoate metabolism
    Sked_28160
   00660 C5-Branched dibasic acid metabolism
    Sked_28160
Enzymes [BR:ske01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Sked_28160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ACZ22718
UniProt: D1BB17
Position
complement(3145800..3146972)
Genome map
AA seq 390 aa AA seqDB search
MDLFEYQARDIFEKHGVPVLGGVVATTPEEARSGAEELGGGTVVVKAQVKVGGRGKAGGV
KLAHTPDEAAARAEEILGMDIKGHTVHRVMIAAGAKIAEEFYFSVLLDRANRSYLAMASV
EGGMEIEQLAVERPEALAKVAVDPIVGIDEAKAVEIAEAAGFADDIKAQVVDAFQKLWTV
YKEEDATLVEVNPLVRTEDGSIVALDGKVTLDENAGFRHAEHADLEDKAAADPLEAKAKE
NDLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEAHGGVKPANFLDIGGGASAEVMAAGL
DVILGDEQVKSVFVNVFGGITACDAVANGIVGALKVLGDAATKPLVVRLDGNNVEEGRAI
LIEAAHPLVTLADTMDGGADKAAELAHASV
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgttcgaataccaggcgcgcgacatcttcgagaagcacggcgtccccgtgctg
ggtggagtggtcgcgaccactcctgaagaggctcgctcaggcgcagaagagctcggcgga
ggaactgtcgtcgtcaaggcgcaggtcaaggtcggaggccgcgggaaggcgggcggcgtc
aagctcgcccacacccccgacgaggcagccgccagggccgaagagatcctcggcatggac
atcaaggggcacaccgtccaccgcgtcatgatcgcggccggtgcgaagatcgccgaggag
ttctacttctcggtgctcctcgaccgggccaaccgctcgtacctcgccatggcgagcgtc
gaaggtggcatggagatcgagcagctcgcggtcgagcggcccgaggccctcgccaaggtc
gccgtggacccgatcgtcgggatcgacgaggccaaggccgtcgagatcgccgaggccgca
ggcttcgcggacgacatcaaggcgcaggtcgtcgacgcgttccagaagctctggaccgtg
tacaaggaggaggacgcgacgctcgtcgaggtcaaccccctcgtccgcacggaagacggc
tcgatcgtcgccctcgacggcaaggtcaccctcgacgagaacgccgggttccgccacgcg
gagcacgccgacctcgaggacaaggccgcggccgacccgctcgaggccaaggccaaggag
aacgacctcaactacgtcaagctcgacggcgaggtcggcatcatcggcaacggcgcaggg
ctcgtcatgagcaccctcgacgtcgtcgcgtacgccggcgaggcgcacggtggggtcaag
cccgccaacttcctcgacatcggcggcggcgcctcggccgaggtcatggccgcgggtctc
gacgtcatcctcggcgacgagcaggtcaagagcgtcttcgtcaacgtcttcggtggcatc
accgcgtgcgacgccgtcgcgaacggcatcgtcggagccctcaaggtcctcggcgacgct
gcgaccaagccgctcgtcgtccgtctcgacggcaacaacgtcgaggagggacgcgcgatc
ctcatcgaggccgctcacccgctcgtgaccctcgccgacaccatggacggcggcgccgac
aaggctgccgagctcgcccacgcgtcggtctga

DBGET integrated database retrieval system