KEGG   Sanguibacter keddieii: Sked_30500Help
Entry
Sked_30500        CDS       T01214                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ske  Sanguibacter keddieii
Pathway
ske00450  Selenocompound metabolism
ske00970  Aminoacyl-tRNA biosynthesis
ske01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ske00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Sked_30500
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Sked_30500
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ske01007]
    Sked_30500
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ske03016]
    Sked_30500
Enzymes [BR:ske01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Sked_30500
Amino acid related enzymes [BR:ske01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Sked_30500
Transfer RNA biogenesis [BR:ske03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Sked_30500
 Prokaryotic type
   Other AARSs
    Sked_30500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: ACZ22950
UniProt: D1BCG3
Position
3395536..3397146
Genome map
AA seq 536 aa AA seqDB search
MDDLYITTSIPYVNGRPHLGHALELVHVDVLARHRRLRGAQVRVQSGTDDHALKNVSAAS
LAGVPVADLVAANGDRFVELVDALGVRTDEFVRTSSDPRHAPGVVALWEACRAAGDLYQK
DYTGLYCPGCEQFYAADELVDGLCGEHGTPVQEVTETNWFFRLSRYRDQVAALVASGEVA
VEPRQRRNEVLGFLAGEVHDISVSRPADRAGGWGVPVPGDPGQVVYVWFDALVNYLTGLG
YGSETGRGAAVGREADAVRGGRESVGAAGEAVEVSVAVDVGVGVEEPFARWWGGGAERTH
VLGKGIARFHAVYWVAFLLSAGLPLPTRVLVHDYLTVDGAKIAKSGSQAADPATVVATYG
PDALRWWLARDPAPVGTTDFTVERLVGCYDRDLANGLGNLVSRTLTLARRDRSWSAPPTA
EVGVEVRAAARALPDAVDAALARYDLRSACEAITGLVEHGNRFIEGEAPWRLARAADAGD
LEAAARFEGVVDALVELCRVATHELEPFVPEGAARLVAQLDAGVGRPVPAFPRIGG
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggacgacctgtacatcaccacctcgatcccctatgtcaacggccgcccgcacctgggc
cacgccctcgagctcgtccacgtcgacgtcctcgcccggcaccggcggctgcgcggcgcg
caggtccgggtccagtctgggaccgacgaccacgcactgaagaacgtcagcgcggcgtct
ctcgcgggcgtcccggtggccgacctggtcgccgccaacggcgacaggttcgtcgagctg
gtcgacgccctcggggtgcgcacggacgagttcgtgcggaccagcagcgacccgcggcac
gcacccggggtggtcgcgctctgggaggcgtgccgggccgccggggacctctaccagaag
gactacaccgggctctactgtcccggctgcgagcagttctacgccgccgacgagctggtc
gacgggctgtgcggcgagcacggcacgcccgtccaggaggtcacggagaccaactggttc
ttccggctgtctcgctaccgggaccaggtggccgcactcgtggcgagcggcgaggtcgcg
gtcgagccacggcagcgtcgcaacgaggtgctggggttcctcgccggcgaggtccacgac
atctcggtgtcgcgaccggcggaccgcgcgggcgggtggggcgtcccggtcccgggcgac
ccgggacaggtcgtctacgtgtggttcgacgcgctcgtgaactacctgaccggcctgggg
tacgggagcgagacgggccggggtgccgccgtcggccgagaggctgacgctgtccgcgga
ggacgcgagtccgtcggtgcagcgggcgaggccgtcgaggtcagcgtggcggtcgacgtc
ggcgtcggcgtcgaggagcccttcgcccggtggtggggcggcggtgccgagcgcacgcac
gtgctcggcaagggcatcgcccggttccacgccgtctactgggtcgcgttcctgctctcg
gccgggctgccgctgccgacgcgggtcctggtgcacgactacctcacggtcgacggcgcc
aagatcgccaagagcgggagccaggccgccgacccggccaccgtggtagcgacctacggt
cccgacgccctgcgctggtggctggcccgtgacccggcgccggtggggacgaccgacttc
accgtcgagcgcctcgtgggctgctacgaccgcgacctggccaacgggctcggcaacctc
gtctcccgcacgctgacgctggcacgccgtgaccggagctggtcggcaccgccgaccgca
gaggtcggggtcgaggttcgggcagccgcgcgcgccctgccggacgccgtcgacgccgcg
ctcgcccggtacgacctccggagcgcctgcgaggccatcaccgggctcgtcgagcacggc
aacaggttcatcgagggcgaggcgccctggcggctcgcccgggccgccgacgccggagat
ctcgaggccgccgcccggttcgagggggtcgtcgacgcgctggtggagctgtgccgggta
gcgacgcacgagctcgaacccttcgtaccggagggggcggcgaggctcgtcgcgcagctc
gacgccggggtcgggcgtcctgtgccggcgttcccgcggatcggcgggtag

DBGET integrated database retrieval system