KEGG   Sanguibacter keddieii: Sked_33540Help
Entry
Sked_33540        CDS       T01214                                 

Definition
(GenBank) phosphate/sulfate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ske  Sanguibacter keddieii
Brite
KEGG Orthology (KO) [BR:ske00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Sked_33540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ACZ23249
UniProt: D1BE28
Position
complement(3755522..3756526)
Genome map
AA seq 334 aa AA seqDB search
MEVALVVVVVALALSFDYTNGFHDAANAIATSVSTRALTPRAALIMAAVMNFAGALLGTE
VAETIAKSIVNLDGAPDHTALVVILCALVGAITWNLITWWFGLPSSSTHALIGGLVGAGL
AGGLGIYGSAIVDKVVLPMIFSPLIGFGLAFFVMVAVLWIFRRASPSKTNRRFRIAQTAS
AAAMALGHGLQDAQKTMGVIYMALLTVGFANAEDGIPLWVKLAAAAAISLGTYSGGWRIM
RTLGRKIIELDPARGFVAESVSAVVLYVNAFVLHAPVSTTHTITSAIMGVGATKRLSAVR
WGVAKNIGIAWVLTIPAAALVAAIMYWILHPILG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtggaggtcgcgctcgtagttgtcgtcgtcgcgctcgcactcagcttcgactacaccaat
ggattccacgacgccgccaacgcgatcgcgacctcggtctcgacccgtgcgctgaccccg
cgcgccgcgctcatcatggcggctgtgatgaacttcgcgggagcgctgctcgggaccgag
gtcgccgagaccatcgcgaagtcgatcgtcaacctcgacggggcgccagaccacacggcc
ctcgtcgtcatcttgtgcgccctcgtcggcgcgatcacgtggaacctcatcacgtggtgg
ttcgggctgccgtcgtcctcgacgcacgcgctcatcggcggcctggtcggtgccggcctg
gccggtggcctggggatctacgggtcggcgatcgtcgacaaggtcgtcctcccgatgatc
ttctcgccgctcatcggcttcggcctcgcgttcttcgtgatggtcgcggtgctgtggatc
ttccgccgggcgtcgccgagcaagacgaaccgccgcttccggatcgcgcagaccgcttcc
gcagcagcgatggcgctcggccacggcctccaggacgcgcagaagaccatgggtgtcatc
tacatggcgctgctgaccgtcggcttcgcgaacgcggaggacggcatccccctgtgggtc
aagctcgccgccgccgcggcgatctcgctcggcacctactcgggcgggtggcgcatcatg
cggaccctcggccgcaagatcatcgagctcgaccccgcccgcggttttgtcgccgagtcg
gtgtcggccgtggtgctctacgtcaacgccttcgtgctgcacgcaccggtgtccaccacc
cacacgatcacctcggcgatcatgggtgtcggcgcgaccaagcgcctctcggccgtgcgc
tggggcgtcgccaagaacatcggcatcgcgtgggtcctcaccatcccggccgccgcgctc
gtggccgcgatcatgtactggatcctgcacccgatcctcggctga

DBGET integrated database retrieval system