KEGG   Staphylococcus kloosii: C7J89_10015Help
Entry
C7J89_10015       CDS       T05401                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
skl  Staphylococcus kloosii
Pathway
skl00471  D-Glutamine and D-glutamate metabolism
skl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:skl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    C7J89_10015
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:skl01011]
    C7J89_10015
Enzymes [BR:skl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     C7J89_10015
Peptidoglycan biosynthesis and degradation proteins [BR:skl01011]
 Precursor biosynthesis
  Racemase
   C7J89_10015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AVQ36464
UniProt: A0A151A5X7
Position
complement(2021208..2022041)
Genome map
AA seq 277 aa AA seqDB search
MDKPIGVIDSGVGGLTVASEIIRQLPNETIYYLGDIKRCPYGPRSGEEVKQFTIQLVEKL
MQYDIKMLVIACNTATAVALEALQERLTIPVIGVIEPGARTAIMTTQNQNVLILGTEGTV
KSEAYRHHIKNINPNVEVTGIACPGFVPLVEQMRYKDPTITSIVIHQTLKQWRNSKADTV
ILGCTHYPLLYKYIYDYFDGTKTVISSGLETAREVSALLTFSNEHAGYKKNPEHKFFATG
DTEHIERIIKEWLNMTVEVEKVNVEEQVTNERYSHSI
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggataaaccaattggagttatagattctggagtaggtggtttaaccgttgctagcgaa
atcatacgacaattgcctaacgaaacaatttattatttaggtgatattaaaagatgtccg
tatggtccaagatctggcgaagaggttaaacagtttacaatacaacttgtagagaaactt
atgcaatacgatattaaaatgttagtcatcgcatgtaatactgctactgcggttgcttta
gaagcactacaagaaaggttaacgataccagtaattggagttattgaaccgggcgcaaga
accgcgataatgacgacacaaaaccaaaatgttttaattttaggaacagaaggtacagtt
aagtctgaagcgtatcgtcatcatataaaaaatattaatcctaatgtagaagtgacaggt
attgcatgtcctggttttgtaccattagtagagcaaatgcgctataaagatccaaccatt
acaagcatcgtcattcaccagactttaaagcaatggcgtaacagtaaagctgacactgtc
attttaggttgtacgcattatccgttactatataaatatatttatgactattttgatggt
acgaagactgttatatcatcaggattagaaactgccagagaagtaagtgcattactaaca
ttcagtaacgaacacgctggctacaagaaaaatccggaacataaattttttgctacagga
gatactgaacacatcgaaagaattattaaagagtggttaaatatgactgtagaagttgaa
aaagttaatgtagaggagcaggttacaaatgaaagatatagtcatagcatctaa

DBGET integrated database retrieval system