KEGG   Saccoglossus kowalevskii (acorn worm): 100313717
Entry
100313717         CDS       T04123                                 

Definition
(RefSeq) REST corepressor-like protein
Organism
sko  Saccoglossus kowalevskii (acorn worm)
SSDB
Motif
Pfam: Myb_DNA-binding ELM2 GATA Myb_DNA-bind_7 HDAC4_Gln
Other DBs
NCBI-GeneID: 100313717
NCBI-ProteinID: NP_001161644
UniProt: D1LXC7
Position
Un
AA seq 570 aa
MVMADRNGDSEMSTRNNGSHVAGASNGHMSDDSASSSSDDEHEPGMRVGEDYQAPIPEMA
NAGDIPPGQRGDGRPEALLVWAPTTDIGDEKLDEYIKVAKEKYGYNTEQALGMLFWHRHD
VDKSLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKSFHRIRQMLPDKSISCLVRYYYSWK
KTRTRTSLMDRQAKKLTVGQKENSGSEEPPSDEENVVDSDFDPEGHRGDGRDKHTCSNCQ
TSSSQVHSTPKGSLCNACYSYWRRTGVMRTNIGPIKNETPRPDRHNPLKSRRKPPRGMYL
DKDDLLALNSPQGDSFLKQLDTELISLKKQMQLNKQILSKQKDKCEFNLEEYKILDNGQR
INARWTNDELLIAVQAVRKYGRDSQAIADVVGNKNTSQVRSFFVNYRRRFNLDQVLEEYE
AEYGHTKQDYKIFDEERINGQNVAHSATPVVTQVPPTSGNSTNAPPPPLLRGPSTSSPSA
PATAPPTQPQVVHRPPPPLQQPSRFLQPPRSVPIQPPPLIRPSTAPSMMAGMTRGRPHIM
GPLGTPPQLVGSQRDTPPHSTQQIKSEITY
NT seq 1713 nt   +upstreamnt  +downstreamnt
atggttatggccgacagaaacggcgattcggagatgagcactcgtaataatggttctcac
gtcgctggagcctccaacggacacatgtcggacgacagcgccagcagcagctcggatgat
gaacacgagccgggaatgcgagttggcgaagattatcaagccccgattccggagatggcg
aacgcaggtgatatccctccgggtcaacgaggtgacggcagaccagaagctcttcttgtt
tgggctccaacaactgacattggtgatgaaaaattggatgagtacatcaaggtagccaag
gaaaaatatggatacaacactgagcaagcactaggaatgcttttctggcaccggcatgac
gttgataaatccctagctgatttacctaatttcaccccattccctgatgagtggaccgtt
gaagacaaagttctcttcgaacaggctttcagttttcatggcaaaagttttcatcgtatt
cgacagatgctaccagacaaatctatcagctgtctggtacgatactattattcatggaaa
aaaactcgtacaaggaccagcttgatggataggcaagcgaagaaactaactgtcggacaa
aaggagaacagcgggagtgaggagccgccgtcagatgaagaaaatgttgtggacagtgac
ttcgatccagaaggacacaggggagatggtcgtgataaacatacatgttccaattgtcag
acatcttcaagtcaggttcattcaactcctaaaggatcattgtgcaatgcttgttatagt
tattggaggagaactggggtgatgcggaccaacatagggccaataaagaatgaaactcca
agaccagatagacataatccattgaaaagtagacgcaaaccaccaagaggaatgtactta
gataaagatgatttattggcattaaattcacctcagggagattcatttcttaaacagttg
gacacagagcttatttcgcttaaaaagcagatgcaattaaataaacaaattttgagcaag
caaaaagacaagtgtgaattcaacttggaagagtataagatattggacaacggtcaaaga
atcaatgcacgatggacaaatgatgaactgcttattgcagtgcaagctgttcgaaaatat
ggaagagattctcaagctattgccgatgttgtgggaaacaagaacacctcgcaagttcga
agtttctttgtcaactaccgacgtcgttttaacctggatcaagtcttggaagagtatgaa
gctgaatatggtcatactaaacaggattacaaaatttttgatgaagagcgtataaatggt
cagaatgtggcccattcggcgacaccagttgtcactcaagtaccaccgacaagtgggaac
tctacgaatgctcctccacctcctctcttgaggggaccatctacttcttctccatcagct
ccagctactgcacctccaactcagccccaagttgtacacagaccaccaccaccattacaa
caaccaagcagatttttgcagcctccacgttctgtgcccatccaaccacctcctttaata
cgtccatcaaccgcaccatcgatgatggcaggaatgacgcgtggtcgcccacatatcatg
ggacccttaggtacaccacctcagctcgttggtagtcagcgagatacacctccacacagt
actcaacaaatcaaaagtgaaattacatattag

DBGET integrated database retrieval system