KEGG   Saccoglossus kowalevskii (acorn worm): 100366936Help
Entry
100366936         CDS       T04123                                 

Gene name
TTN
Definition
(RefSeq) titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Brite
KEGG Orthology (KO) [BR:sko00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sko01001]
    100366936 (TTN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sko04131]
    100366936 (TTN)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sko04812]
    100366936 (TTN)
   04147 Exosome [BR:sko04147]
    100366936 (TTN)
Enzymes [BR:sko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100366936 (TTN)
Protein kinases [BR:sko01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   100366936 (TTN)
Membrane trafficking [BR:sko04131]
 Others
  Actin-binding proteins
   Others
    100366936 (TTN)
Cytoskeleton proteins [BR:sko04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     100366936 (TTN)
Exosome [BR:sko04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100366936 (TTN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 Pur_ac_phosph_N fn3_2 GPI-anchored
Motif
Other DBs
NCBI-GeneID: 100366936
NCBI-ProteinID: XP_006823013
Position
Un
AA seq 3783 aa AA seqDB search
MTIKWVPPQSDGGNKIITYIIEKKEQYKTRWEQVNDYTVIETVFTVRNLKEGNEYEFRVL
AENQAGTSKPSESSEPRIAKPPYDLPGAPMTPEVSDVNATHMTVTWRPPRNDGGSPIIGY
IIERKDTSSNRWIKSNRDTVSDMRFTVRDLVEGSEYEFRVSAENKAGVGPPSEPSDRRKA
KPPYDAPDAPSKPQVSDITATTMNLTWKPPHNDGGSPVTGYIVEKREKFSTRWDKANRYN
VTDTQFKVTDLKQGKEYEFRVTAENKAGVGKPSDPSESRIAKPPYDVPGPPGTPKVSDVN
ATSMKLTWTPPQDDGGSPVTGYYIEKKEQFSARWARVNTMPVTDISYSVERLTEGSPYEF
RICAENKAGVGKPSDSTGPHTAKAPYTVPDAPGKPKVMEVQATSMTIKWMEPESDGGSKI
TNYVVERKDEFSSRWSKVFTDEKSLDTAFTVTGLNEGSNYQFRVAAENKAGVGKYSEPSD
IKTAKPPYGLPDAPGKPVVSDIDATKMTLNWTPPLDDGGAPVKGYIIEKKEGFSSLWTKV
NRFDVTETTYTVTDLKEKSEYQFRIAAENKAGVGKYSEPSDPKVAKPPYDVPGPPGTPKV
SDVAATSMKLTWTAPEDDGGSPVTGYVVEVKEQFAFRWSRVNKFTITDLHMTVKDLKENS
VYEFRVCAENKAGVGKPSQSTGPHTAKAPYTVPDAPGKPKVTEVQATSMTVKWTEPESDG
GARITNYVIEKKEEFSTRWGKIHLDEPIVDTSCIVPGLTEGTDYQYHVAAENKAGIGKYS
EPSDTKTAKHPYGLPDAPGKPVVSDIDATKMTLNWTPPLDDGGAPVKGYIIEKKEGFSTF
WNKVNRFDVSDTKYTVTDLKEGTEYQFRVAAENKAGVGKYSEPSDPRIAKPPYDVPGPPG
TPKVSDVAATSMKLTWTAPEDDGGSPVTGYVVEVKEQFAFRWSRVNKFTITDLHMTVKDL
KENSVYEFRVCAENKAGVGKPSQSTGPQTAKAPYTVPDAPGKPKVMEVQASTMTLKWTEP
DSDGGARITHYIIERKEQFGTRWSKVYTDETIVDTAFIVTGLTEGSEYQFRVAAENKAGV
GKYSEPSDPKVAKPPYGLPDAPGKPVVSDIDATKMTLNWTPPLDDGGAPVKGYIIEKKEG
FSTFWNKVNKLDVTDTTFTVTDLKEKSEYQFRIAAENKAGVGKYSEPSDTKTAKPPYDVP
GPPGTPKVSEITATSMKLTWTTPHNDGGSPITGYVVERKDQYGTRWTHINKFSIPDLHLT
VQDLKENSVYEFRVCAENKAGVGQPSQSTGPHTAKAPYDLPSAPGKPLVSGITATTMTIK
WTEPESDGGAKITNYVIEKKEDFSTRWTKLYTDKLADTEYTVTGLKEKSEYQFRVAAENK
AGVGKYSEPSDPKVAKPPYDVPGAPDKPSTSDVTATSMTVSWYPPDNDGGSPVTGYFVER
KEQFSTMWTRVNTYSVKETSLNVSQLKEGSDYQFRVIAENKAGPGKPSEPSEPRKAKPPY
DLPGAPNQPDVTKIDATHMTLTWRPPYSDGGSPITSYIIEKFDVTRRRWTKAHHGKITET
THTVTELTEHTEYQFRVAAENKAGMGPFSEPSDKKLAKPPYGPPGKPKVSSVEATAMTLT
WSEPSSDGGARIISYVIEKKEKFSSRWVRLTKDTIPDTTYRVTGLTEGTEYEFRVAAENK
AGVGKPSEPSDPRIAKPPYDKPGAPGKPTLFDVTDIAMSLKWTPPTDDGGSPVFNYIIER
REKFTTRWSRISNVTVSDTTFTATGLQKGNEYEFRVSAENKAGVGPPSDSSGPRIAKPPY
DSPDSPGAPDIVDAKPSSLTLKWTPPKDDGGTPITGYMVEKKEKFSSRWVKENITPVKET
TYQVSGLTEGKDYEFRILAENKAGSGKPSFPATLKISVPEAPERPEVIEVTESSASMKWA
APEYDGGARITGYIVEKRETSKDHWTRVNRTPVKETFVSAADLIRGAEYEFRVSAENKAG
ISEPSKPSRPVVVKPPYDVPEAPNKPDVYNVTKKSVTLTWNPPLSDGGSPISQYILQMKE
QFSMRWTVKARVPDAKYVVTDMKEGSVYEFKVSAENKAGVGPASPSVTVTAKDPYVRFLA
SFPIIQLDVPGAPDVPRVTEVTHHSVNLQWNPPTSDGGAPIISYLVEKKQKFSTKWVPAT
REKVPDLTCTVSNLEQMTEYQFRVAAVNKAGVGKPSEPTKAVLTKAAHGIALSFVFKIFL
FIFHPLHLTVEVPDAPGKPSVSDITATSMTLKWTPPEKDGGSPVTGYIIQKKDQFSSRWE
KVNLYKITETTFVVESLREGSTYEFRVCAENKVGVGKPSDATDSKVAKPPYDLPGAPGRP
DVTDSHATTISISWKPPRNDGGSPIIGYIIERKDTSTSRWIRCNRDALPDLHFMIKDLFE
GSEYEFRVSAENKAGVGPPSEPSDPRKAKPPYGVPDAPGKPNITDVTSTTVTLNWRAPLS
DGGALITSYVIEKREKFSTRWVKTNKFAVTETSFKVTDLKHGTEYEFRVAAENKAGVGKP
SEPAGPVIAKPPYDVPGPPGTPDVSDTTSTSMTLTWTPPRVDGGSPVTGYIIEVKEQFST
RWAKVNKMSIPDLSFTVGNLKQNSVYEFRVAAENKAGIGKPSDSTGPHTAKPPFNVPDAP
GKPKITSVTATTMTINWSPPLSDGGSRITNYVIEKKEPFGLRWAPVSRDENVTEMTYTVH
DLIEGSEYQFRVAAQNKAGSGKFSEPSDVRQAKPPYGVPGSPGKPVVSDIDATQMTLNWT
PPQKDGGSPVTGYTVEKKEKRSSFWTKANRFDVKDTRFTVTDLKQGSEYEFRVAAENKAG
VGKYSEPSDSRIAKMPFDVPGPPGIPKVSEITATSMKLNWTPPENDGGSPVTGYFVEVKE
QFTYRWSRLNQFRVPDLHLTVQDLKENSVYEFRVCAENKAGVGQPSHSSGPFTAKPPYDV
PGPPSAPKVVDTTATTVTIRWTEPEYDGGNRITNYIIEKKEEFSTRWIKVATDANIMDTH
YSITGLTQGSVYHFRVAAENKAGIGIYSEPSDLVKAKPPYDVPGPPDKPRVTKVDSNEMI
LTWISPAKDDGSPITGYIIEKKEAFSSFWSKAAHLTTPETSATLSGLREGTEYQFRVAAE
NKAGVGKYSEPSDPRIAKPPYDVPGAPTKPRVIEVDATYMTISWVPPKSDGGSPVTNYIV
EKYDTSRGRWSRAHREKITNVQYTITELVEGTEYQYKVAAENKAGVGPFSEPSEKMRAKP
PYDIPGPPGKPKISDVIATAMTLSWSAPHTDGGAVITNYIIERREKFSTRWIRACHADIM
DTTYRVADLVERSEYEFRVSAENKAGVGPPSEPTAPHMAKPPYDKPDTPSQPVISQVSDK
SMTLNWEAPPSDGGSPIFNYVVEKKDKFSVKFMKVNDYNVSDTHLIVTGLHKGNEYEFRV
SAENKAGISKPSPSSRPILAKPPYDVPGAPGIPSMSDVKPTSLHLTWTAPTDDGGSPVTG
YIIEKREKFGTRWVKDNKTPVLDASYTVRDLTEGSDYEFRVLAVNKAGAGTPSNPVTLKL
SVPEAPGIPTVYGVKATQATVQWTPPESDGGARITGYYVERHDTSKERWVRTTRTSVKET
VQTVTELIKGAEYEFRVSAENNVGVGEPSKPSKPVIAKPPYDIPDTPGTPLVSNVSKMTM
TLTWAAPHSDGGSAITNYVIDKKEKFSSRWMPAARTTDLVYNATDLRENSEYQFRVSAQN
AAGISVPSEPSRPTVAKDPYSKWTTRLSAWLLECVHPYSSHEDLSAWFLSFLHLTLGLLF
FVL
NT seq 11352 nt NT seq  +upstreamnt  +downstreamnt
atgacaataaaatgggtgccacctcagtctgatggtggcaataaaattatcacttacatc
attgagaagaaagagcagtataaaacacgatgggaacaagttaatgattacacagtgatt
gaaacagtattcactgtcagaaatctaaaggaaggtaatgagtatgagttcagagtactt
gctgagaaccaagcaggtactagcaaacccagtgagtcatcagaaccaaggattgcaaaa
ccaccatatgatttacctggagcaccaatgactcctgaagtgagcgatgtcaatgcaaca
cacatgactgttacatggagaccacccaggaatgatggaggaagtccaatcattggttac
atcattgaaagaaaagataccagcagtaacagatggattaaatctaacagagatactgtc
tctgatatgagattcactgtgcgagatcttgtagaaggatctgagtatgaatttagagtt
tctgctgaaaacaaagctggtgttggacctcctagtgaaccatcagatagaagaaaagcg
aaacctccatatgatgcaccggatgctccaagtaaaccacaggtttcagacatcactgcc
actaccatgaatttgacctggaaaccccctcacaatgatggtgggtcacctgtcactgga
tatattgttgaaaaacgagagaagttctccacaaggtgggacaaagccaatagatacaat
gtgacagatacacagttcaaagttactgatttaaaacagggcaaggaatatgaatttaga
gtcactgcagaaaacaaagcaggtgttggaaaaccaagtgacccttcagaatcaaggatt
gccaagccaccatatgatgtgccaggcccaccaggtactcctaaagtatctgacgttaat
gctacatccatgaagctgacctggacaccacctcaggatgatggtggttctcctgtaacc
ggatactatatcgaaaagaaggaacaattctctgcaagatgggcacgtgtcaacacaatg
cctgtgacagacatcagttacagtgttgaaagactcactgaaggctcaccatatgaattc
agaatatgtgcggagaacaaagctggtgttggcaaaccaagtgattcaactggaccacac
acagccaaggcaccatacactgttcctgatgctcccggaaagcccaaagtaatggaagtc
caagctacatccatgaccatcaagtggatggaaccagaatctgatgggggaagtaaaatc
accaattatgttgttgaaaggaaagatgaattctcctccagatggagtaaagtttttaca
gatgagaaatcacttgatacagcatttactgtcactggtctcaatgaaggatctaactat
cagttccgagttgctgctgaaaacaaagctggtgttggcaaatacagtgaaccatcagat
attaagactgccaagccaccatatggtctgcctgatgctcctggtaagccagttgtctct
gacattgatgctaccaagatgactctgaactggactccacctttggatgatggtggtgca
cctgttaaaggatatatcattgagaagaaagaaggattctcatcactctggactaaagtc
aatagatttgatgtgacagaaacaacatacaccgtaactgacctgaaggaaaaatctgaa
tatcaattccgaattgctgctgagaacaaagctggtgttggcaaatatagtgaaccatca
gatcctaaagttgccaaaccaccatatgatgttccaggtccaccaggtaccccaaaagta
tctgacgttgctgctacatccatgaaactgacttggacagcaccggaagatgatggtggt
tctcctgtgaccggatatgttgtggaagttaaagaacagtttgcattccgatggtccaga
gtcaacaaattcaccataacagatttacacatgactgttaaagatctgaaagaaaactca
gtttatgaattcagagtatgtgctgagaacaaagctggtgttggtaaaccaagccaatct
acaggaccacacacagccaaggcaccatacactgttcctgatgcacccggcaaacctaag
gtaactgaagtacaggcaacaagtatgacggtgaaatggacagagccagaatctgatggt
ggagcaagaatcaccaactacgtcattgagaagaaagaagagttcagcacaagatgggga
aagattcatcttgatgaaccaattgtggacacaagctgtatagttcctggtttaacagaa
ggcactgactatcaataccatgttgctgctgagaacaaagctggcattggcaaatatagt
gaaccatctgatactaagactgccaaacatccatatggcctgcctgatgctcctggtaag
ccagttgtctctgacattgatgctaccaagatgactctgaactggactccacctttggat
gatggtggtgcacctgttaagggatatatcattgaaaagaaagaaggattctcaactttt
tggaacaaggtcaatagatttgatgtctcagatacaaaatatacagtcactgatctgaaa
gaaggcactgaataccaattccgagttgctgctgagaacaaagctggtgttggcaaatac
agtgaaccatcagatccaaggattgccaaaccaccatatgatgttccaggtccaccaggt
accccaaaagtatctgacgttgctgctacatccatgaaactgacatggacagcaccggaa
gatgatggtggttctcctgtaaccggatatgttgtggaagttaaagaacagtttgcattc
cgatggtccagagtcaacaagttcaccataacagatttacatatgactgttaaagatctg
aaagaaaactcagtttatgaattcagagtatgtgcagagaacaaagctggtgttggtaaa
ccaagccaatctacgggaccacaaacagccaaggcaccatacactgtaccagatgcacct
ggtaaacctaaagtaatggaagtccaggcatcaactatgacactgaaatggacagaacca
gattctgatggaggtgctagaattactcattacatcattgaacgaaaagaacaatttggc
acacgctggtccaaggtgtacactgatgaaacaattgtggatactgcttttattgttact
ggactcactgagggctcagaatatcaattccgtgttgctgctgaaaacaaagctggtgtt
ggcaaatatagtgagccatcagatcctaaagttgccaaaccaccatatggtctacctgat
gctcctggtaagccagttgtctctgacattgatgctaccaagatgactctgaactggact
ccacctttggatgatggtggtgcacctgttaagggatatatcattgaaaagaaagaagga
ttctcaactttctggaacaaagtaaacaaattagatgttactgatacaacattcacagtg
actgacctaaaggaaaaatcagaataccaattccgaattgctgctgagaacaaagctggt
gttggcaaatacagtgaaccatcagatactaagacagccaagccaccatatgatgtacca
ggtccaccaggcactccgaaggtatcagaaattacagctacatccatgaaactgacctgg
acaacaccacataatgatggtgggtctcctataaccggatatgttgttgagcgtaaagat
cagtacggaacaagatggactcacattaacaagttctccatcccagatctacacttgact
gttcaagacttgaaggaaaattctgtatatgagttccgtgtctgtgctgagaacaaagct
ggtgttggtcaaccaagccaatccactggaccacatacagctaaggcaccttatgatcta
ccaagtgcccctggtaaaccacttgtatctggtatcactgcaactactatgaccattaaa
tggacagaaccagaatctgatggaggagctaagatcaccaactatgtcattgagaagaaa
gaagatttcagtacaagatggacaaaattgtacacagacaaattagctgatactgaatac
acagtgactggtctgaaagagaaatcagaataccaattccgtgttgctgctgagaacaaa
gctggtgttggcaaatacagtgaaccatcagatcctaaagttgccaaaccaccatatgat
gttcccggagctcctgacaagcccagtacatctgatgtgactgctactagtatgactgtt
agctggtatccacctgataatgacggtggttcacctgtaactggatactttgtagaaaga
aaagaacaattctcaacgatgtggactagagttaatacatattcagtgaaagagacatct
ttgaacgtttctcaattgaaggaaggctctgattatcaattccgtgtaattgctgagaat
aaggctggtcctggtaaaccaagtgaaccaagcgaaccaagaaaagccaaaccaccatat
gatcttcctggtgcaccaaatcaacctgatgttaccaagattgatgcaactcacatgaca
cttacatggagaccaccatactctgatggcggcagtcctattacttcatacattattgag
aagtttgatgtaactaggcgaagatggactaaagcgcatcatgggaaaatcactgaaact
acacatacagtgaccgagctgacagaacacaccgaatatcagtttagagtggctgcagag
aacaaagcaggaatgggaccattcagtgagcctagcgataagaaactagctaagccacct
tatggtcctccaggtaaaccaaaggtttcatccgtagaagctactgcaatgacactcacc
tggtctgagccatcatctgatggtggagcaagaatcatcagttatgtcatcgagaagaaa
gaaaaattcagttctcgctgggtaagacttaccaaagacactatcccagacaccacctac
agagtcactggattgaccgaaggtaccgaatatgaattcagagttgctgctgagaacaaa
gctggggttggtaaaccaagtgaaccatcggatccaaggattgccaaaccaccatatgac
aaacctggcgcacctggaaaaccaactttgtttgatgtaactgatatagccatgagcttg
aaatggactccacctacagatgacggaggcagtccagttttcaactatatcattgaaaga
agagaaaagttcacaactagatggtctcgaatcagcaatgttacagtgtctgatacaaca
ttcacagcaacaggattacaaaaaggcaatgaatatgaattcagagtgagtgccgaaaac
aaagcaggagttggtccacccagtgattcatctggcccaaggatcgctaaaccaccatat
gattcaccagattcaccaggtgcaccagacatagttgatgctaagccttcatctttaact
ctgaaatggactcctccaaaggatgatggtggaacgccaatcactggatacatggttgaa
aagaaagaaaaattcagctctcgctgggtgaaagaaaatattacaccagtcaaagaaaca
acataccaagtctcgggactgactgaaggtaaagactatgaattccgtattctagcagag
aacaaagctggatcaggaaagcctagcttcccagccaccttaaagatttctgtaccagag
gcaccagaaagaccagaagttattgaagtcactgagtcatcagccagtatgaaatgggca
gcaccagagtatgatggaggtgctagaataactggctacattgtggagaagcgagaaacc
agtaaagatcactggacaagagtgaaccgtacaccagtgaaagagacttttgtatctgct
gctgatttaatacgaggagctgaatatgagttccgtgtttccgcagaaaataaggctgga
atcagtgaaccaagcaaaccatctcgacctgtggttgtgaaaccaccatatgatgttcct
gaggctccaaataagcctgatgtatacaacgttactaagaagtctgtgacactcacatgg
aacccacctctctctgatggtggtagtccaatatctcagtacattcttcaaatgaaagaa
cagttttccatgcgatggactgtaaaagccagagttcctgatgctaaatatgttgtgact
gatatgaaagaagggtctgtttatgaattcaaagtgtctgctgagaacaaagctggtgtt
ggtccagctagtccatcagtgactgtcactgctaaagatccttacgtcaggttcttagcc
tcttttcctatcatccaactagatgttccaggggctcctgatgttcctcgtgttactgaa
gtcactcatcattcagtaaatttacaatggaatccccctacatctgatggtggtgctcct
attattagctatttggtggaaaagaaacagaagttcagcactaaatgggtcccagcaaca
cgtgagaaagtcccagacttgacatgcactgttagcaatctcgaacagatgactgagtat
cagttcagagttgctgcagtgaacaaagcaggtgttggtaaaccaagtgagccaacaaaa
gcagttcttactaaggctgctcatggtattgctttgtcttttgtcttcaaaatctttctt
tttatctttcatccccttcatctcactgtagaagtcccagacgcccctggtaaaccttct
gtctctgacatcaccgctacgtcaatgaccctcaaatggacaccccctgaaaaagacggt
ggtagtcccgttacaggctacatcattcagaagaaagatcagttcagctccagatgggaa
aaagtcaatctatacaaaatcactgagaccacctttgttgttgagagtctcagagagggt
agcacatatgagtttagagtgtgtgctgagaacaaagtgggtgtaggcaaaccaagtgat
gcaactgattctaaggttgctaaaccaccatatgacttacctggtgcccctggcagacca
gatgtgactgattcacatgccacaactatcagtatctcatggaaaccacctagaaatgat
ggtggaagtcccattattggatatatcattgaaaggaaggatacaagcacatcaagatgg
attagatgtaatagagatgcactacctgatcttcacttcatgattaaagatctatttgaa
ggaagcgagtatgagtttagagtcagtgctgagaacaaagctggtgttggaccaccaagt
gagccatctgacccaagaaaggccaaaccaccatatggtgtacctgatgctcctggtaaa
cccaacattacagatgttacatcaacaactgttaccctcaactggagagctccactctca
gatggaggtgctctcattacaagctatgtaattgaaaagagggagaaattctcaactcga
tgggtcaaaacaaataaatttgccgtgacagaaacatcatttaaagtaacagatctaaaa
catggaactgaatatgaattccgtgttgctgcagaaaacaaagcaggtgttggaaaacca
agtgaaccagctggcccggtcattgccaaaccaccatacgatgtacctggtccacctggc
acacctgatgtatctgatactacatcaacatcaatgacactaacctggacaccacctaga
gttgatggtggttctcctgtaactggatatatcattgaagtcaaagagcaattcagcacc
agatgggcaaaagtcaacaagatgagcataccagatctttctttcactgttggtaatctg
aagcagaattctgtctatgagttccgagtggctgctgagaacaaagctggaattggtaaa
cctagtgattccactggtccacatacagccaagccgccattcaatgtaccagacgcacct
gggaaacctaagataacatctgtgactgcaacaaccatgaccatcaattggtctccacca
ttatctgatggtggcagcaggataactaattatgttattgaaaagaaagaaccatttggt
ctgagatgggctccagtcagtagagatgagaatgttacggaaatgacttacactgttcat
gatctgattgaaggatctgaatatcaattccgagtagcagctcaaaataaagctggaagt
ggtaaattcagtgaaccatctgatgtcagacaagctaaaccaccatatggcgtaccaggt
tctcctggtaaaccagttgtctcagacatcgatgctacccagatgacgctcaattggact
ccacctcagaaggacggaggctcacctgtcacaggatatacagtagaaaagaaagaaaaa
cgttccagtttctggaccaaggccaacagatttgatgttaaggatacaagatttacagtg
actgacttaaaacaaggatctgaatacgagttcagagttgccgctgagaacaaagctggt
gttggcaaatacagcgaaccatctgactcaagaattgccaagatgccatttgatgtacca
ggaccaccaggtattcctaaagtgtctgaaattactgcaacctcaatgaaacttaactgg
acaccacctgaaaatgacggcggttcaccagtaactggatactttgtagaagtaaaagaa
caatttacatacagatggtccagactaaaccagttccgtgtaccagacttgcatttgact
gttcaagatttgaaggaaaattctgtgtatgaattccgtgtctgtgctgagaacaaagct
ggtgttggtcaaccaagccattccagtggtccattcacagctaaaccaccatatgatgtg
cccggacctccatcagcacctaaagtggtggatacaacagccacaaccgtgacaattaga
tggactgaaccagaatatgatggtggtaaccgtatcacaaactacatcattgagaagaag
gaagagttttcaacgagatggatcaaggtggcaactgatgccaatattatggatactcac
tattcaatcactggactcactcaagggtctgtatatcatttccgagttgcagctgaaaac
aaagcgggtattggtatatatagtgaaccatcagatcttgtaaaggccaaaccaccatat
gatgtacctggcccacctgacaagcctagagtcactaaagttgacagcaatgaaatgatc
ttgacatggatttcaccagcaaaggatgatggaagccctattacgggatacatcattgaa
aagaaagaagcattctcatcattttggtccaaagctgcacatttaacaacaccagagaca
agtgcaacgttatctggactcagagaaggaactgaataccaattccgtgttgctgctgag
aacaaagctggtgtcggcaaatatagtgaaccatcagatcctaggattgccaaacctcca
tatgatgttcctggtgcaccaaccaaaccacgagtgattgaagttgatgcaacctacatg
acgatatcctgggtaccaccaaagtctgatggtggtagtccagtcactaactatattgtg
gagaagtacgataccagccgaggacgatggagtagagctcatagagagaagatcaccaat
gtccaatatactattactgaacttgttgaaggcacggaataccaatacaaagtggctgct
gaaaacaaagcgggtgttggtccatttagtgaaccaagtgaaaaaatgagagcaaaacca
ccatatgatattccaggtccaccaggcaaacctaagatttctgatgtcattgctactgct
atgacattatcttggtcagctcctcacaccgatggtggggctgtgataaccaactacatt
attgaacgaagagagaaattcagtaccagatggatccgagcttgtcatgccgatatcatg
gacaccacatacagagttgcagacttggttgaacgcagtgaatacgaattcagagtgtca
gcggaaaataaagcaggtgttggtccaccaagtgaaccgactgccccacatatggcaaaa
ccaccatatgataaacctgatacacctagtcaacctgtgatctctcaagtatctgacaaa
tctatgactctcaactgggaagcaccaccatcagacggtggttctccaatatttaactat
gtggttgagaagaaagataaatttagtgtcaaatttatgaaagtaaatgattacaatgtc
agtgatacacatctcattgtgactggattgcataaaggaaatgagtatgagttccgggtc
agtgctgagaacaaagccggtatcagtaaaccaagtccatctagcagacctatattagct
aaaccaccatatgatgtaccgggtgcacctggtattccatcgatgtccgatgtgaagcca
acatccttgcatctgacctggacagcccctactgatgatggtggatctcctgttaccgga
tatatcattgaaaagagagagaaattcggcaccagatgggtaaaggataacaaaacacct
gttcttgatgcctcttacactgtaagagacttgacagaaggaagtgactatgaattccgt
gtattagctgtgaacaaagctggtgctggcacacctagcaatccagtgactctgaaacta
tctgttcctgaggcacctggaataccaactgtgtatggtgttaaggcaacgcaggcaact
gtacagtggacaccaccagaatcagatggaggagctagaatcacagggtattatgttgaa
aggcatgatacaagcaaagagcgttgggtaagaaccacaagaacatctgtgaaagaaact
gtacagacagtaacagaactgattaaaggagctgagtatgagtttagagtgtcagctgag
aataatgttggtgttggtgaaccaagtaaaccatcaaaaccagttattgctaagccacca
tatgatattcctgatactcctggaacaccattggtgtctaatgtctcaaaaatgaccatg
acattaacttgggctgctccccactctgatgggggtagtgctatcaccaactatgtcatt
gacaaaaaagaaaaattcagctcacgatggatgccagctgctaggacaacagatcttgtc
tacaatgccactgatctgagggaaaactctgaataccagttccgtgttagtgcccaaaat
gctgcaggtattagtgttccaagcgagccttctagaccaactgttgctaaggatccgtat
agtaagtggaccacaagactctctgcatggctcttggagtgtgtgcatccttactcgtca
catgaagacttgtctgcatggttcttgtcattcctacacctcacattaggtcttctgttc
tttgttttatag

DBGET integrated database retrieval system