KEGG   Saccoglossus kowalevskii (acorn worm): 100367237Help
Entry
100367237         CDS       T04123                                 

Definition
(RefSeq) titin-like
  KO
K12567  titin [EC:2.7.11.1]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Brite
KEGG Orthology (KO) [BR:sko00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sko01001]
    100367237
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sko04131]
    100367237
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sko04812]
    100367237
   04147 Exosome [BR:sko04147]
    100367237
Enzymes [BR:sko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100367237
Protein kinases [BR:sko01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   100367237
Membrane trafficking [BR:sko04131]
 Others
  Actin-binding proteins
   Others
    100367237
Cytoskeleton proteins [BR:sko04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     100367237
Exosome [BR:sko04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100367237
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 ig Ig_2 V-set Pur_ac_phosph_N C2-set_2 C1-set Ig_4 THB Izumo-Ig GPI-anchored DUF11
Motif
Other DBs
NCBI-GeneID: 100367237
NCBI-ProteinID: XP_006823016
Position
Un
AA seq 4695 aa AA seqDB search
MKCKVTGLPRPDVQWFKKKAKVKITARTVIEYTDDGVCMLTLHNLGLDDITTYTCKATNK
VGEASTSAELILQVAAKITEGPANMSVKRGHTIPLKCTFRGIPKPDVFWYRGKNEIESTG
RYAIEVKETYSILTIEDIQPDDSCEFSMEVENEHGMDQHKLTITVYDKPSAPGKPEVSDI
TPSTLTLTWEPPTSDGGSPITSYIIERCDVTTNTWTVLTTSNKTTTYSVKNLAPDTQYVF
RVSAENVVGVSEPSPESDIVNTLKKPEPEVAAEKVAEPQEALKAPYFIDQLKDKDATDGD
PVQFVCKVTGKPLPVITWYRNDELIKPSQDFKQTYTNEIAVLDIVEVFPDDAGRYTCKAV
NPAGDAVTRAKLRVEELPEESPPAVEEFEAPKIVEKFKDLELIEGKTARLECLVTGKPEP
EVTWYKDDCEIKNSRHIYAKRDGNKCTLIIANVNLDDDAEYTCRAKNPVGKTECAAEVLI
ETPEEAAAEFLIKPKKVETVQAEIPIDPDKPKEPPFFIQEPVKTTSIEGEPAEFRCKVGG
YPPPKVTWNKGWRQLTDGREFTLKYDEETEEHVLIVKETRSNSSGKYTVKIENEVGADKT
NVPLLVEVKPEEEPQYTQVLKRRPSEIARMEAEEIDINELLKDVDPKDYEKVLLEHGIHD
FRVILKHIEWLKQQGDKELDLPKLKGWEEVLAEETIAAPVKLQEVHADRPQVMALARETI
PEDSEVPTFAFAKPLKDVEVVEKDTAQLVCEVTDERAEVTWMKDGQIIEPGDERFIIEKV
GRRCSLVVKDTTILDEAEYTCQLGELQTTAELLVEEVEPIKTKVTIVDGIETKEATAEQT
VMFECVVSDETGKATWFKDGDEIEPSEKYEIKVEGRRRSLTIHNISSDDEADYTCTVDED
KTAAELFYKEPVKIIKSLTDQTVKEHLTATYECEFSLPIQKHEVKFFLNNELLKETSNVI
IKVSGTKATIVMKDVVDKDEGEISVKVRNATSTAKMNVELPPFEISKGLHDASAEEKQTG
TFQCQVSDQRAKVTWLKNGEPITLDETKYTSVSQGKIRKLVISDLAFDDKAEYSVMLQDQ
KSTATLDVEPAKIAPFFIEKPKFADVVEDSPAEFRCKVGGYPTPVISWSKGWKQCTECDE
YTITYNEETEEHTMIINKTTIKDAGKYTVKAVNEMGEQKVPVSLMVQEKPAEEPQFMKKL
KRRPSQVKVETKPEDIDIEELLAGVPVKDYELVLRKHGIHDFRVILQHIEMMKKKKIEEE
IKPIVEPEVEVVKAEIETVSAAPQLTVAVKTEEVVYNFVKDLEDVEVVENEAVELTCEVS
DEKAEVSWLKDGVEIKPDDDKYEFKSSGRRRSLCLKSATVKDEAEYTCVVGDTSTTAELF
VEDKVQPIPEIEEVTVVCAPVTSLEEATIAPVKFLYKLKDTDVEENQTARLDCEINQDVS
DDDISWSKDDEQLLPGDKYEMLKAKRKVSLIIHDVSFEDEGDYTVSVGSSTSTAGLFVSE
APKFATPLQDKEIPEKESIELTCEVTKPNVKVNWYKDDEQISPYDHHYKIKTDGRRHSLV
IDDVKLKDEAKYTAKLGDIETAAELVVEEIVEDIVEEPVICSAVASLQQPTQLEEAKIEL
AKPIEDKEVDEFTESVSFSCQLTRPTNDVTWLKDDQPIDESDKYKIVKEDTSHTLIVSDV
TTEDEGIYTFKAGDVKTDAELLVELTKFGEQLKDIQCSEFEPVTLECEVTNKLASVTWLK
DQEEVKESPRVKISTDGTKHMLTILETIPEDEAEYTCKVGAVTTSCELLVDTTTFTSTLA
DKDVSEFEKSTFECEVSNEKANVTWLKDGQPIEEGPKYTITVDGKKRTLLVHDITPDDDA
EYTCVVGDHKTTCGLFVEATKFSSPLKSTDAIEFESVTLECEVSHDKGQVTWFKNGKEIE
PSDKYRIEVDGQTRRLIISDLTCEDVAEYTCVIGTEKTSTTLNVKATGFSSQLKDVDATE
FEATVLECELSHEKGVITWLKDGKPIEEGPKYTFIVDGKKRALKIEDVSPDDDAEYTCVV
GDEKTTAGVFVEDTSFTTKLNDSDALEFESVTLECVVSHERAHVVWLVNDVELQPSEKYE
FVAIGKTRKLIIHDLSISDDAEYTCVFGKEMTTAAVTVETTKFTTKLSDIDATEFESATY
ECEVSHEKGEVIWLKDGKPIEESPKYKIIVDGKKRALIIQDVSVDDDAEYTCVMRDEKTS
ANTFVEATTFTSPIKDIDAIEYENEKLECVVSHEKATVTWLKDGQPIEEGPKYTFVADGK
KRSLLINDVNPDDDAEYTCVIGEEKCTAGLFVCATKFTKELKDVDVIERETARFDVEVSH
EKAEVTWLKDGKEIEPSMRYEYKVDGKQRSLIIHGVTPDDEAEYTCVLGKEKSNGGLFVE
PPPVEFVVPVKPVDVIERQTAAFECEISEDAEVTWQKDGEDIQPSEKYEYISEGKIRKLV
IHNCNFEEEAEYTCVTKDHKSNAELVVLEAAPEFKEPLKDVTTMEESDSCTLQCTLDKIT
TNVKWMKNKEVITESAKYEFVHDEYTHKLIVKDNVLEDDAEYTCVVGEYTSEANIKVEEK
PVEIVEGLKEVVASPDDTISFTCVLNKERVNVKWFKNDEEIKPSDKYEMTKDFKTHKLVV
KNAVFEDDAEFSFVAESEASRADLIVEDEPKVTVEPKFMEITVKAETKIVVESSFTGAPA
PESEWTKDGNKLDVTDDRIKVQATKAMRGNTTLTINKAKRSDKATYTVTVSNDLGTDSVN
VVVNVLDKPTPPTNLKISEITPETVTLNWEPPEDDGGDVVTEYTIEKRDTKRATWSDAGT
TSDLTFQVKKLIEGNEYVFRVSAVNKHGTSEPTQTSPIIAKHQFDVPMPPTKPEISDVDR
TVMTVTWSPPEFDGGSPVTGYFVERCDTARDRYIRVNKDSITETSLIVHDLVEGNEYVFK
IYAQNEAGPSKPSPASDPRIAKPPYDAPEAPGKPETENIERTEMKVSWTPPENDGGSPIT
GYIVEKCDVARDRWVKAHKETVLETELLVKDLMEGNTYKFRVFAENAAGLGPASKPSEPR
IAKPPYDPPSAPGKPETSDVDATVMTVTWTTPETDGGSPITSYIIERRDTFSTRWVKVNK
DIVLDNSYKVTNLVEGTEYQFQIMAENKAGVGPASEPSDLRKAKPPYDPPNAPGKPDITA
VDSTEITITWTPPENDGGSPITGYTIERCDISRKRWITCNKQTVTETTFTITELIEGNEY
QFRVAAENKAGVGDMSEPSDVTKAKPPYDVPTAPGKPEVTGTMPTYITITWAVPESDGGS
PITNYVIEKRDTTRDRWVKGSKEVITDTVFSVPDLLEGNEYEFRVAAENKAGIGAFSEPS
DKAVAKLPYDVPEAAGKPEVLNADATEMTIEWTPPEKDGGSPVIGYVIEKQKDGGRWLKV
NKDIVPELTYTVQELVEGSEYRFRVSAQNAAGVGKPSEPSDPRIAKPPYDVPTAPGKPET
SDVDKTEMTITWTPPLSDGGSEIFNYIIEKRETNVTRWVKATKVTITECTYKLTDLKEGL
KYEFRVSAENKAGVGPVSPPSDPRIAKPPYDPPSAPGKPKITDIDSNHMTLTWTVPDNDG
GSEIIGYVIEKCDTNRDRWLRVNKELVKELTLTVTDLIEGNEYIFRVAAENKAGLGNYSE
PSDPKVAKPPYDLPEAPGKPEVENLDKTSMNLTWAPPKSDGGSAIFNYVIERKETSSSRW
VKIHKDTWVSTEFTVLDLIEGNEYEFRVAAENKAGVGNYSEPSDPRIAKPPYDVPGPPSK
PILGEIDRTVMTVTWTPPESDGGSPIIGYFVEKKEQFSSRWTKVTDIVVSELTLKVSNLT
EGSLYQFRVSANNKAGTGTPSEPTEPTMAKPPYDPPEPPSRPEVSDVTAETMHLTWNPPD
NDGGSPITGYFIEKRDVTRDRWSKVNKDAVKNPKLTVENLTEGTTYEFRVSAKNDAGVGN
PSEPSVPTKAKPPYDIPESPGKPDVTDVTASTMTLTWAAPVSDGGSPITTYVIESKDSFS
TRWNNITKDKITDLTYTVSGLMEGSEYQFRIKAQNAAGLSKPSQPSDPVIAKPPFVVPGA
PSKPVISDVTAMSMKLTWNAPGSDGGSPITGYSVEARERLGTWTVITLDAVQETSYTATS
LIEGKVYEFRVSAQNKAGLSKPSPPSDPTEAKDPIDPPCPPGKPEPTNISGTEMKVTWSM
PENDGGSPIIGYIVERCETARMRWMKSNTDLVKETTYLVQDLIEGNTYTFRIIAVNKAGE
SEPSEPSEPKVAKPPYDVPEPPSKPNISDVDATQMTLTWTPPEHDGGSPVTGYIIERKDS
MSIKWVKAVRDVVTDTTITVKGLIEGTEYQFHVAAQNKAGTGKFGEPSDPRIAKPPYDIP
GPPGMPSVTSADSTWMTLTWSPPEDDGGAEITNYIVEMKEGFSTTWKKVVRNVSDTTHTV
KNLTEGNEYEFRVSAENKAGVGPPSEPSTPRVAKPPYDVPGPPGKPDVTETDKTMMTITW
TPPEEDGGSPLTGYVIEKCDISRDRWTKANRITVTESTFQVTDLIEGQKYIFRVSGENKA
GVGKPSEPSEPRIAKLPYDVPDAPGQPEVSKVDSTAMTLTWAAPDNDGGSPVTGYVIEKK
DVTSTRWVRVNKDIEIDTTLRVTQLIEGTTYEFRVSAQNKAGVGKPSEPSKPQKAKPPYG
KIENLLACLLYLHGE
NT seq 14088 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgtaaagtcactggtttaccaagaccagatgtgcagtggttcaagaaaaaagct
aaagtcaagataactgcccgcacagtgattgagtacaccgatgatggagtttgtatgcta
actttgcataatcttggtttggatgatattactacctacacctgtaaagcaaccaacaaa
gtgggagaagcatcaacatctgctgaactcatcttacaagtggcagcaaagattacagaa
gggcctgctaacatgtcagtgaaacgtggacatactatccctctcaaatgtactttccgt
ggcatccccaaaccagatgttttctggtatcggggaaagaacgagatagaatctacaggt
agatacgctattgaggtgaaagagacctattccattttaacgattgaagacattcagcca
gatgattcttgtgaattctcaatggaagtggaaaatgaacatgggatggatcaacataaa
ctgacaattacagtatatgataaaccttctgcaccaggtaaaccagaagtttctgacatc
actccatccacattgactctgacatgggagccaccaacatctgatggcggaagtcccatt
acatcatacatcattgagaggtgtgatgtgaccacaaacacttggactgtattgacaact
agcaacaagaccacaacgtactctgtgaaaaacttggcaccagatacacaatatgtgttc
cgtgtgagtgcagaaaatgttgttggtgtgagtgaacctagtccagaatctgacattgtc
aacactcttaaaaaaccagaacctgaagtagctgctgagaaagttgctgaaccacaagaa
gcactgaaggcaccatactttattgatcagctgaaggataaagatgcgactgatggagat
cctgttcaatttgtctgcaaagtgactggtaaaccacttcctgtcatcacctggtacagg
aatgatgaattaatcaaaccatcacaagacttcaagcagacttacacaaatgaaattgct
gtcctggacattgttgaggtgttcccagatgatgctggcagatatacttgtaaagctgtc
aatccagctggcgatgcagtgaccagagctaaactcagagtagaggaattaccagaagaa
tcacctccagctgttgaagagtttgaagctccaaagattgttgaaaaattcaaagattta
gagctcattgaaggcaaaacagcaagattagaatgtcttgttactggcaagcctgaacct
gaagttacttggtataaggatgattgtgaaatcaaaaacagtcgtcacatttacgctaaa
cgtgatggtaataagtgtactttgatcattgcaaatgtcaacttggatgatgatgcagag
tacacatgcagggcaaagaatcctgttggtaaaactgaatgcgctgctgaagtcttaata
gaaacaccagaagaggctgctgctgaattcctaattaaaccaaagaaagttgagacagta
caggctgaaataccaattgatcctgacaaacctaaagaacctccattctttattcaagag
ccagtgaaaacaacatctattgaaggtgaacctgctgagtttcgttgtaaagtcggtgga
tatcctcctcctaaagttacatggaacaaaggatggagacaactcacagatggaagagag
tttacacttaaatatgatgaagagacagaggagcatgtgttgattgttaaggaaactcga
agtaattcttctgggaaatacacagttaagattgagaatgaggtcggtgctgataaaact
aatgtaccattgttggttgaggttaaaccagaagaagaaccacaatatacccaagttctg
aaaagacgaccttccgaaatagcacgtatggaggctgaagaaattgacatcaatgaactt
ctgaaagatgtggatccaaaagactatgagaaagtgctattagaacatggtattcatgac
ttccgtgtaatcttaaaacatattgagtggctgaaacagcaaggggataaagaattagac
ttacctaagcttaaaggttgggaagaggtcctagctgaggaaactattgcagcacctgta
aagctacaagaagtacatgctgacagaccacaggtgatggcattagcaagagagacaatt
ccagaagacagtgaagtacccacgtttgctttcgcaaagccgttgaaagatgttgaagtt
gttgaaaaagacactgcccaacttgtttgtgaagtgacggatgaaagagctgaggtgacg
tggatgaaagatggtcagattatcgagccaggtgatgaaagattcatcattgagaaagtc
ggaagacgatgctctcttgttgtcaaagatacaactattttggatgaagccgagtatacc
tgtcaacttggagagttacaaactactgctgaactgcttgtggaagaagtggaaccaatc
aagaccaaagtgaccattgtcgatggaattgagaccaaagaggcaactgctgagcagact
gtaatgtttgagtgtgttgtctcagatgagactggtaaggctacatggtttaaagatggg
gatgaaattgaaccatctgagaagtatgaaatcaaagtggaaggaagaagacgctctctc
acaatccataatatttcatctgatgatgaagcagattacacatgtacagttgatgaggac
aaaactgcagctgaactcttttacaaagaaccagtgaagatcatcaaatctctgacagac
cagactgtcaaagaacatctgacagctacatacgagtgtgaattttcactgccaatccag
aaacatgaagtgaaattctttttgaataatgaactattgaaggagacgagtaatgtcatt
atcaaggtctctggtaccaaggcaacgattgtaatgaaggatgtggtcgacaaggatgaa
ggcgaaattagtgtcaaagttcgcaatgcaacttccactgcgaaaatgaatgttgagcta
ccaccatttgagatatctaaaggacttcatgatgcaagtgcagaagaaaaacagactggg
acattccaatgtcaagtgtctgaccaaagagctaaagtcacatggttgaaaaatggtgaa
ccaattacattggatgaaacaaaatatacctcagtatcacaaggaaagataagaaagctt
gtgatcagtgatctggcatttgatgataaggcagagtactctgtcatgctccaggaccag
aaatcgacagccacgttagacgttgaacctgctaaaattgctccattcttcatagaaaaa
ccgaaatttgcagatgttgtcgaagattctcctgctgaattccgttgtaaagttggtggt
tatccgacacctgtaatatcatggtctaaaggatggaagcagtgcacagaatgtgatgaa
tacacaataacatacaatgaagaaactgaagagcatacaatgataattaataaaacaaca
attaaagatgctggcaaatacactgtcaaagctgtcaatgagatgggtgagcagaaagtc
cctgtgtcattgatggtgcaggagaaaccagctgaagaaccacagtttatgaagaagttg
aagaggagaccatctcaggtgaaggttgaaacaaaacctgaagatattgatattgaagaa
cttctagctggagtacctgtgaaggactatgaactggttctgagaaaacatggcatccat
gattttagagtcattctacagcatatagaaatgatgaaaaagaagaagatagaagaagaa
attaaaccaattgttgaacctgaagttgaagttgtaaaagctgaaattgagacagtttct
gcagccccacagttgacagtagcagtaaaaacggaagaagtcgtgtataactttgtgaaa
gatttagaggatgttgaagtcgttgaaaatgaagctgttgaactcacctgtgaagtctca
gatgaaaaagctgaggtgtcttggttaaaggatggtgttgagattaaaccagatgatgac
aaatatgaatttaaatcatctggtagacgtcgatctttgtgtctaaagagcgccactgtc
aaagacgaggcagaatatacatgtgtggtcggtgatactagtaccactgccgaactcttt
gttgaagacaaagttcagcctataccagaaattgaagaagtgacagtggtttgtgcacca
gtcacaagcctagaggaggctaccatagctcctgtcaaattcttgtacaaactaaaagac
actgacgttgaagaaaaccaaactgcaaggctagattgtgaaattaaccaagatgtttct
gatgatgacatctcgtggagcaaagatgatgaacaattgcttcctggagacaagtatgaa
atgctaaaagccaaacgtaaagtctcgttgatcattcatgatgtgagctttgaagacgaa
ggtgactacactgtttctgttggttcaagcacaagtacagctggactttttgtatcagaa
gcacccaaatttgccactccattgcaagacaaagaaattcctgagaaagaaagcatcgag
ttgacatgcgaagtgaccaaacctaacgtgaaggtgaattggtacaaggatgatgagcag
atctcgccatatgatcaccattacaagataaagactgatggaaggagacatagtttagtc
atcgatgatgtcaagttgaaagatgaagctaaatatacagctaagcttggtgatattgag
actgctgctgaactggttgtagaagaaattgtggaagatattgttgaggagcctgtaata
tgttctgcagtagccagtctgcaacaacctacacaacttgaagaagctaaaattgagctt
gccaaaccaatcgaagataaagaagttgatgagttcacagagtccgtcagcttttcatgc
cagctcactcggccgacgaatgatgtcacctggttgaaagatgaccaaccaatagatgag
agcgataagtacaagattgtgaaagaggatacatcacatacactcattgtgtctgatgtt
accactgaggatgagggaatatatacattcaaggctggtgatgttaaaacagatgctgaa
ctcttagttgaactgaccaaatttggtgaacaactgaaagacattcagtgcagtgaattt
gaaccagtcactttagagtgtgaagtcaccaacaaattggctagtgtcacttggttgaaa
gatcaggaggaagtcaaagaaagtccacgtgtgaaaatcagtactgatggaaccaagcac
atgctgactattttagagactattccagaagatgaggctgaatatacatgtaaagtgggt
gcagtgactacttcctgtgaactattagttgacacaaccacttttaccagtactctggca
gacaaagatgttagtgagtttgagaaatccacttttgagtgtgaagtatccaacgaaaag
gctaatgttacttggttgaaggacggtcaaccaatcgaagaaggacctaagtacaccatc
actgtagatgggaagaaacgaaccttgcttgtccatgacattactcctgatgatgacgct
gaatatacatgtgttgttggcgatcacaaaacaacttgtggtctatttgttgaagccacc
aagttcagttcccctttgaagagtactgatgccattgaatttgaatcagtcacattggaa
tgtgaggtatctcatgataaaggtcaggtgacctggttcaagaatggtaaagagattgaa
ccaagtgataaatacaggatagaagttgatggtcagactagacgtctcattatctcagat
cttacttgtgaagatgttgctgagtatacctgtgtgattggtactgagaaaacttccact
acactcaatgttaaagctaccggattcagttcacagttgaaggatgttgatgctacagag
tttgaagctactgtacttgaatgtgaactctcccatgagaaaggtgttatcacttggttg
aaagatggcaaacctatagaggaaggacccaagtatacctttattgtggatggcaaaaag
cgtgctctcaagatcgaggatgtctctccagatgatgatgcagaatacacttgtgttgtt
ggtgatgagaagaccactgctggtgtatttgttgaagatacttcattcactacaaaactc
aatgactctgatgcactagagtttgagtcagtgacacttgaatgtgtagtgtctcatgaa
cgagcccatgtcgtgtggcttgtcaatgatgtagaattgcaacctagtgagaagtatgaa
tttgttgccattggaaagacccgtaaactgataattcatgatttgagcatctcggacgat
gccgagtacacatgtgtttttggaaaagaaatgaccactgctgccgtaacagtggaaact
actaaatttaccactaaactatctgacattgatgctactgagtttgaatcagcaacatat
gagtgtgaagtatctcatgaaaagggtgaagtcatctggttgaaagatggtaaaccaatt
gaagaaagtcccaaatacaaaataattgttgatggcaagaaacgtgctcttataatccaa
gacgttagtgttgatgatgatgctgaatacacatgtgtgatgagggatgagaaaacatcc
gcaaatacttttgtagaagctactacattcacatcaccaataaaggacattgacgctatt
gaatatgagaatgaaaaattagaatgcgtggtatctcatgagaaagcaacggttacatgg
ttgaaagatggtcagccaattgaagaagggccaaaatacacctttgttgcagatggtaaa
aagcgttctttgctgataaatgatgtcaatccagatgatgacgctgaatacacctgtgtt
attggcgaggagaaatgtacagctggtctgtttgtttgtgcaactaaattcactaaggaa
cttaaggatgtggatgtgattgaaagggagacagctagatttgatgttgaggtgtcccat
gaaaaagctgaagtgacttggcttaaagatggcaaagagattgaaccaagtatgagatat
gaatataaagtggatggaaaacaacgctcattaattattcatggtgttactccggatgat
gaagcagagtatacatgtgtgttgggcaaagaaaagtcaaatggtggactctttgttgaa
ccaccacctgttgaatttgttgtcccagtcaaaccagtggatgtcattgaacgacagaca
gcagcttttgaatgtgaaatctcagaggatgctgaagtcacatggcagaaagatggtgaa
gatatccaacccagtgagaaatatgagtatatatcagaaggcaaaatcagaaaattagtc
atacataactgtaactttgaagaagaggctgaatatacatgtgttaccaaagatcacaaa
tccaatgccgaactggttgtgctagaagcggcacctgagttcaaggaaccattaaaagat
gtaacaacaatggaagaatctgattcttgtactctgcaatgtaccctagataaaataaca
accaatgtgaaatggatgaaaaacaaggaagtgatcacagagtctgccaagtatgagttt
gtacatgatgagtatacacataaattgattgtcaaggacaatgtattggaagatgatgct
gaatacacttgtgttgttggagaatatacgtctgaagctaacataaaagtagaagaaaaa
ccagtggaaattgtagaaggcctcaaagaagtggttgcaagtcctgatgacacaatcagc
ttcacttgtgtcctcaacaaagagcgagtgaatgttaagtggttcaagaacgatgaagaa
attaagcctagtgataaatacgagatgacgaaagacttcaaaactcataaactggttgtc
aaaaatgctgtatttgaagatgatgcagagttttcatttgttgctgaaagtgaggctagc
cgtgctgatctcattgttgaagatgaaccaaaggttacagttgaacctaaatttatggag
atcacagtgaaagcagaaaccaaaattgttgttgagtctagcttcaccggtgctcccgct
ccagaatctgaatggactaaagatggaaacaaactggatgtgactgatgatcgcatcaaa
gtacaggctaccaaggcgatgagaggaaacaccacactgactatcaacaaggccaagaga
agtgataaagctacttacactgttactgtgtctaatgatttgggaacagactctgtcaat
gttgttgtcaatgttttagacaaaccaactccacccaccaatctcaaaatcagtgaaatt
acacctgagactgtcaccttgaactgggagcccccagaagatgatggtggcgatgtcgtc
actgaatacaccattgagaagcgtgatacaaaacgagcaacatggtctgatgctggaacg
acttcagatctcactttccaagtcaagaaattgatagaaggcaatgagtatgtgttccgt
gttagtgctgtaaataaacatggtacaagtgaacctactcaaacatctccaatcattgct
aaacaccaatttgatgtaccaatgccacctactaaacctgaaatatctgatgtggatcga
acagtaatgacagtcacatggtcaccaccagaatttgatggtggtagtccagtcacaggc
tactttgttgaaagatgtgacactgcaagagatagatatatcagagttaacaaagacagc
attacagaaaccagcttgattgtccatgacctggttgaaggaaatgaatatgtattcaaa
atttatgctcaaaatgaagctggaccaagtaaaccttctccagcatctgatccaagaatt
gcaaaaccaccatatgatgcacctgaagcaccaggtaaacctgaaacagagaacattgaa
cgtactgaaatgaaagtatcttggacaccaccagagaatgacggcggatcaccaatcaca
ggatacatcgttgagaaatgcgatgtcgctagagatcgttgggtgaaggcgcataaggaa
actgttctagaaactgagttgcttgtgaaagatttgatggaaggcaatacttataaattc
agagtctttgcagaaaatgcagcaggactaggaccagctagtaaaccatcagaaccaagg
attgctaaaccaccatatgatcctccaagtgctcctggtaagccagaaaccagtgatgta
gatgccacagtgatgacagtcacatggacaacacctgaaactgacggtggttctccaatc
acaagttatattattgaaaggagagacaccttctcaactagatgggttaaagttaacaaa
gacattgtgctggacaacagttacaaagttaccaacttagttgagggaacagaataccag
ttccagatcatggcagagaacaaggctggtgttggccccgccagtgaaccatcagatcta
cggaaggctaaaccaccatatgacccaccaaatgcacctggtaaaccagatatcacggct
gtagacagcacagaaatcaccatcacttggacaccaccagagaatgatggtggttcacca
atcacaggatacactatagagcgatgtgatatcagcaggaagaggtggatcacatgcaat
aaacaaaccgttactgagaccacattcaccatcactgagttgattgaaggcaatgagtat
cagttcagagtagctgctgagaacaaggcaggagttggagatatgagtgaacccagtgat
gtcactaaagctaaaccaccatatgatgttcctactgctcctggcaaacctgaagtaacg
ggcacaatgcctacttacatcaccatcacatgggcagtaccagaatctgacggaggatct
cccatcaccaattacgtcattgagaaacgagacactacaagagatagatgggtgaaagga
agcaaggaagtcatcacagatacagtgttcagtgttcccgatctcttagaaggcaacgaa
tatgagttccgagttgctgctgagaacaaagctggtattggagcattcagtgaaccatct
gacaaagctgtagctaagctaccatatgatgtaccagaagcagcgggtaaacctgaggtt
ctcaatgctgatgccactgaaatgacaattgagtggacaccaccagaaaaagatggtggc
agcccagttattggttatgtgattgagaaacagaaagatggtggtagatggctgaaagtg
aataaagatatagtccctgagctgacctatacagtacaagaattggttgaaggctctgag
tatcgatttagagtcagtgcacagaatgcagctggagttggtaaaccaagtgaaccatca
gatccaagaattgccaaaccaccatatgatgtccctactgcacctggtaagcctgagact
tctgatgttgacaagactgagatgacaatcacgtggacacctccactctccgatggcggt
tctgaaattttcaactatatcattgagaagcgagaaaccaacgtgactcgctgggttaaa
gctaccaaagtcactattactgagtgtacctacaaactgactgatctgaaagagggtctt
aaatatgaattcagagttagtgcagagaataaggctggtgttggaccagttagtcctcca
tctgatccaagaattgccaaaccaccttatgacccaccttcagctcctggaaagcctaag
attacagatattgacagcaatcatatgactctaacatggactgttcctgacaacgatggt
ggcagtgaaattattggctatgttattgagaaatgcgacacaaatagagacagatggctg
cgtgtgaataaagaattagttaaggaacttactctgacggtgacagatctcattgaagga
aatgaatacatcttccgagttgctgctgagaataaagctggcctgggcaattatagtgaa
ccatcagatcctaaagttgccaaaccaccatatgaccttcctgaggcaccaggcaaacct
gaagttgagaacctagacaaaacatctatgaatttgacatgggcaccacctaagagtgat
ggcggaagtgcaatctttaactatgtaattgaaagaaaagaaacatcttctagtcgatgg
gttaaaatccacaaagatacatgggtttctactgaattcacagtgttggacttgatagaa
ggcaatgaatatgaattccgtgttgctgcggagaacaaagctggtgttggcaattacagt
gaaccatcagatccaaggattgccaagccaccatatgatgtgcctggtccaccaagcaaa
ccaatactcggtgaaattgatcgcacagtaatgactgtgacatggactccaccagaatct
gatggtggttctccaatcatcggttactttgttgaaaagaaggaacaattcagtagtcgc
tggactaaagtcactgacattgtagtatcagaactgacactgaaggtctctaatttaact
gaaggcagcttgtatcaattccgtgtttctgctaataacaaagctggtactggaacacca
agtgaaccaactgaacctaccatggccaaaccaccatatgatccaccagaaccacctagt
cgacctgaagtcagtgatgtcactgctgaaaccatgcacctgacatggaatccaccagac
aatgatggtggttcacctatcactggatacttcattgaaaaacgagatgtcaccagagac
agatggtcaaaggtcaacaaagatgctgtcaagaatcctaaattgacggttgagaatttg
acggaaggtacaacctatgaatttagagtcagtgctaagaatgatgctggtgttggtaac
ccaagtgaaccatctgtacctactaaagctaaaccaccgtatgatataccagagtcacct
ggtaaacctgatgttactgatgtcactgcatcgactatgacccttacgtgggcagcacct
gtatccgatggtggcagtcccattaccacatatgtcatcgaaagcaaggactccttttcc
acaagatggaataatatcactaaagacaagatcacagatctgacatacactgtttctggt
ctcatggaaggatctgagtaccagttccgtatcaaagcacaaaatgctgctggtctgtct
aaacctagtcagccttcagatcctgttattgccaagcctccatttgttgtacctggtgca
ccaagtaaaccagttatctctgatgtaacagccatgagcatgaaactaacatggaatgcc
ccaggtagcgatggtggttctcctatcactggctattctgttgaggcaagagaacgtctt
ggaacatggacagtcatcacactggatgcagtacaggaaaccagttatacagctacaagt
ctcattgaaggcaaagtatacgagttccgtgtctcagcccagaacaaagcaggtcttagt
aaacccagtccgccatcagatccaacagaagcaaaagatccaattgatcctccctgtcca
cctggcaaaccagaaccaactaacattagtggtactgagatgaaagtcacatggtccatg
ccagagaatgatggtggatctcccattattggatacattgttgaacgctgtgaaacagct
agaatgagatggatgaagtcaaatacagaccttgtgaaggaaaccacttatcttgtccag
gatttgattgaaggaaacacctatacatttagaattatagcagttaataaggctggtgaa
agtgagccaagtgaaccatcagaaccaaaggttgccaaacctccatatgatgtaccggaa
ccacctagcaaacctaatatcagtgatgttgatgctactcaaatgactctgacctggaca
ccacctgaacacgatggtggatcaccagttacaggatatattattgaacgtaaagatagc
atgagcattaagtgggtgaaggctgttcgagatgtagtgactgacacaacaatcactgtt
aaaggtcttattgaaggaactgaataccaattccatgttgctgcccagaacaaagctgga
accggaaagtttggtgaaccatcagatccaaggattgccaaaccaccatatgacattcca
ggtccaccaggaatgccttctgtgacatcagcggacagcacatggatgactttaacatgg
tctcctccagaagatgacggcggtgcagaaatcaccaattatatagttgagatgaaggaa
ggattcagtacaacatggaagaaagtagtgagaaatgtctctgatacaacacatactgta
aagaatctcactgaaggaaatgagtatgagtttagagtcagtgctgagaacaaagctggt
gttggaccaccaagtgaaccatccactccaagggtggccaaaccaccatatgatgtacct
ggtccacctggtaaaccagatgttactgaaactgacaagacaatgatgacaataacttgg
actcctccagaagaggatggtggaagcccacttactggatatgttattgagaaatgtgac
atcagtagagacagatggacaaaagctaataggattactgtaactgagtcaacattccaa
gttactgatctcattgagggacagaagtacatatttagagtcagcggtgaaaacaaggct
ggagttggtaaacctagtgaaccatcagaaccaagaattgccaaactaccatatgatgta
ccagatgcacctggacaaccagaagtgagcaaggttgattccactgccatgacattgaca
tgggcagcacctgacaatgatggtggtagccctgtgactggttatgtcattgaaaagaaa
gatgtgacaagcactcgctgggttagagttaataaagacatagagattgatactactcta
agagttactcagcttattgaaggcacaacttatgaatttagggtcagtgctcaaaataag
gctggggtcggtaaaccaagtgaaccatctaaaccacaaaaagctaaacctccatatggt
aagattgagaatttattggcatgcttgttgtatctgcatggtgaataa

DBGET integrated database retrieval system