KEGG   Saccoglossus kowalevskii (acorn worm): 100367263Help
Entry
100367263         CDS       T04123                                 

Definition
(RefSeq) acetylcholinesterase-like
  KO
K01049  acetylcholinesterase [EC:3.1.1.7]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100367263
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sko00537]
    100367263
Enzymes [BR:sko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     100367263
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sko00537]
 Enzymes
  100367263
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3 Peptidase_S9
Motif
Other DBs
NCBI-GeneID: 100367263
NCBI-ProteinID: XP_006816660
Position
Un
AA seq 407 aa AA seqDB search
RIDVVMLLAGCCILPRGSIARQDPLEVRIKSGVVRGKTVSLPDDRGDTLAFLGIPFAEPP
VGDLRFREPVPISKWDGGYDATNFGNSCMQQLEKLYPDFPGAQMWDPNTPVSEDCLYLNV
WTPSPKPNNAAVMVWIYGGAFIGGTASLDVYDGKYLAGTQDIIMVSMNYRVGSFGFLATG
DQRATGNYGMYDQVLALKWVKSNIGAFGGNPNRITIFGESAGAASVGLHLLSPLSEPLFN
RAILQSGTPDAEWAVMTHDEAETRSQILGSFHGCNFAQSDFVDCLRNVNASDLSALEWVT
SQFSKMPWTPIVDGKFLLNDPKSLVSNGQFKNADVLLGSVKDEGTYFILYGFVPGYEKDS
TNLQTYENYLANVDYTNSDLNTCSRAAIKDHYTHWESPMMVLLTVIT
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
agaatagatgtcgttatgttgctggctggttgctgcattcttccccgagggtcgatagct
cggcaagaccctctcgaagtcaggattaaaagtggtgtagttcgtggcaagactgtgagt
ttgcctgatgaccgaggcgatacgcttgctttcctaggaataccttttgccgagccccca
gtcggagacctccgttttcgtgagcctgttcccatatcaaagtgggatggtggttatgat
gctactaattttggaaattcctgcatgcagcaactggaaaagttgtatcctgattttcca
ggcgcacagatgtgggatcctaatacaccagttagtgaagactgcttgtacttgaatgtg
tggactccatcaccaaaaccaaataatgcggcggtcatggtttggatatatggtggtgca
tttattggtggcacagcttctcttgatgtctacgatgggaaataccttgcaggaactcag
gatattatcatggtatcaatgaactatcgtgttggttcatttggtttcttagcaactgga
gaccaaagagctacaggaaactatggaatgtatgaccaagttcttgccttgaaatgggtg
aaatctaacattggtgcttttggaggaaatcctaataggattactatttttggagaaagc
gctggagcagcaagtgtaggcctacatttactgtcaccattgagtgagccattattcaat
cgcgccatattgcagagtggtacacctgatgccgagtgggctgtgatgacccatgatgag
gccgagacgagatcccaaattcttggttcatttcatgggtgcaatttcgctcaaagtgac
tttgtggattgccttcgcaatgttaatgctagtgacctgagtgcactcgaatgggtaact
tcacagttttcaaaaatgccatggacccccattgttgatggaaagtttttactgaacgat
cctaaaagtttggttagcaatggtcaatttaaaaatgcggacgtactattaggatctgtc
aaggatgaaggaacatattttattttgtatggatttgtaccaggatatgaaaaagactcc
actaacttacagacatatgaaaactatttagccaatgtagattataccaactctgatttg
aatacttgttccagggcagctattaaagaccactacacacactgggaatcgcccatgatg
gtgttgctaaccgtgataacttag

KEGG   Saccoglossus kowalevskii (acorn worm): 100367670Help
Entry
100367670         CDS       T04123                                 

Definition
(RefSeq) acetylcholinesterase-like
  KO
K01049  acetylcholinesterase [EC:3.1.1.7]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100367670
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sko00537]
    100367670
Enzymes [BR:sko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     100367670
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sko00537]
 Enzymes
  100367670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3
Motif
Other DBs
NCBI-GeneID: 100367670
NCBI-ProteinID: XP_006816200
Position
Un
AA seq 419 aa AA seqDB search
MGDDVAPGNYGFLDQVEALRWVQQNIAAFGGNPNEVTIFGESAGAISIHYHVLSPLSKGL
FKRAILQSGTATMIGFFQSDASKTNKIAHGQGKIAGCEKDNSKELIECLRTAPADKFRNS
SDPESGVIANATGLEDIFVPFPPTMDGVFLTEDPKDAVRGNVFNGEEFMIGTMADEGFMM
YFMLFPDEHSELTVNKTVYDEIYAMYFLDKNQAVLDVIKLIYVDWDHADEENANYLSAMS
QMAGDAFFVCPSDEAARAFYGAGFDTYLYQMTHASATTFWPIKTGTALHGDDVQFVFGYT
LLSEMQLVLGGDEKTLFKQTPNKDDINVSLKIMKYWTNFAKTGNPNRSSASDEDNNDDWP
LFTVPGLAYKQLSLSMENSNALKARECAFWNEFLPKLQQSGETCESKEESKYSDEANKP
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgacgtagcacccggtaactacggtttcctggatcaagtagaagcacttcgt
tgggtgcaacaaaatatagcagcgttcgggggaaatccgaatgaagttactatatttggc
gagagtgcaggagcaataagtatacattatcacgtgttatctccattgagtaaaggatta
tttaaaagagctattctgcagagtggcactgctaccatgattggattctttcaatccgat
gcatctaagactaacaagatagcacatggtcagggtaaaattgctggatgtgagaaagac
aacagtaaagagctcattgaatgtcttcgtactgcaccagctgacaagtttagaaattca
tcggatccagaatcgggagtcattgcaaatgccaccgggcttgaagatatatttgtacca
ttcccaccaactatggatggtgtatttctgacggaagacccaaaagatgctgtcagagga
aatgttttcaatggcgaggaattcatgattggcactatggctgacgaaggatttatgatg
tatttcatgttatttccagacgagcacagtgagttaaccgtgaacaagactgtgtatgat
gaaatctatgctatgtatttcctagataaaaaccaagctgtcttggacgtaattaaacta
atttacgtggactgggaccacgctgatgaggagaatgccaactacctctcagcgatgagt
caaatggcaggggacgcattttttgtttgtccatctgacgaagctgcacgcgctttttat
ggtgccggatttgatacgtatttgtaccagatgacacacgcatcggcaacgactttctgg
cctatcaaaactggcacggcacttcatggagatgacgtccaatttgtttttggttacact
ctgctatccgagatgcagttagtccttggtggtgacgagaagactctatttaagcaaacg
ccaaataaagatgatataaatgtttcattgaagataatgaagtactggacgaattttgcc
aaaactggtaatcctaatcgtagttctgcaagtgatgaagataacaacgatgactggcca
ttgtttacagtgccaggtttagcgtataaacaactctcattatcaatggagaatagtaac
gcattgaaagcaagagaatgtgcattctggaatgaatttcttccaaagcttcagcaatct
ggtgaaacttgtgaaagcaaagaagaatccaaatactccgacgaagcaaacaagccttag

KEGG   Saccoglossus kowalevskii (acorn worm): 100368126Help
Entry
100368126         CDS       T04123                                 

Definition
(RefSeq) acetylcholinesterase-like
  KO
K01049  acetylcholinesterase [EC:3.1.1.7]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100368126
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sko00537]
    100368126
Enzymes [BR:sko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     100368126
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sko00537]
 Enzymes
  100368126
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase
Motif
Other DBs
NCBI-GeneID: 100368126
NCBI-ProteinID: XP_002734532
Position
Un
AA seq 273 aa AA seqDB search
MDGVFLTKDPKDGGNVFNGEELIIGTMADEGFMMYYMLFPDEDSELTVNKTVYDEMYAMY
IPDKNQAVLDVIKLIYIDWDHADEENANYLSALNHMGGDMIMVCPTDVAARAFYRAGLNT
YLYQMTHAPAKSIWPIKTGMALHGDDIQFVFGYTLLSEMQLALGGDEKTLFKQTPKKDDI
NVSLKIMKYWTNFAKTGNPNRSSASDEDNNDDWPLFTVPGLAYKQLSLSMENSNALKARE
CAFWNQFEPKLQKSGETCESKEESKYSEEANKP
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggatggtgtatttctgacgaaagacccaaaagatggaggaaatgttttcaatggcgag
gaattgataattggcactatggctgacgaaggattcatgatgtactacatgttatttccg
gatgaagacagcgagttaactgtgaacaagactgtgtatgatgaaatgtatgccatgtat
attccagataagaaccaagctgttttagacgtaatcaaactaatttacatagactgggac
cacgctgatgaggagaatgccaactacctctcagcgttgaatcacatgggaggggatatg
ataatggtttgtcccactgacgtagctgcacgcgctttttatcgtgccggactcaatacg
tatttataccagatgacacacgcaccggcaaagtcaatctggcctatcaaaactggcatg
gcacttcatggagatgacatccagtttgtctttggttacactctgctatccgagatgcag
ctagctcttggtggtgacgagaagactttgtttaagcagacgccaaaaaaagatgatata
aatgtgtccttaaagatcatgaagtactggaccaattttgccaaaactggtaatcctaat
cgtagttctgcaagtgatgaagataacaacgatgactggccattgtttacagtgcctggt
ttagcgtataaacaactctcattatcaatggagaatagtaacgcattgaaagcaagagaa
tgtgcattctggaatcaatttgaaccaaagcttcagaaatctggtgaaacttgtgagagc
aaagaagaatccaaatactctgaagaagcaaacaagccttag

KEGG   Saccoglossus kowalevskii (acorn worm): 100370293Help
Entry
100370293         CDS       T04123                                 

Gene name
ACHE
Definition
(RefSeq) acetylcholinesterase-like
  KO
K01049  acetylcholinesterase [EC:3.1.1.7]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100370293 (ACHE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sko00537]
    100370293 (ACHE)
Enzymes [BR:sko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     100370293 (ACHE)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sko00537]
 Enzymes
  100370293 (ACHE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase AChE_tetra Abhydrolase_3
Motif
Other DBs
NCBI-GeneID: 100370293
NCBI-ProteinID: NP_001306897
UniProt: A0A0A7DYB7
Position
Un
AA seq 612 aa AA seqDB search
MVSCALFACIYISLMLNYSAQADEDYDYVVSTMYGKVRGYRIQVTEKYVDQYLGIPYATP
PVDELRFKPTTPHQPWKGTLNGTRYGKGCMQLPDTQFGDFEGTNMWNPNVLLDEDCLYLN
VWTPHPRPTNAAVMVWIYGGGFVAGVASLEVYHGATLAATEGTIVVSFNYRVASLGFFYL
GHEDAPGNIGLLDQVLALQWVQDNIIHFGGDPTRVTIFGESAGSVSVGLHLLSPVSRNLF
ARAILQSGTPNNPWATVTADEARRRSLKLSKELGCYNEHSMTNNEDIALCMRRQDARDLI
SSEWFDDMHGIYRFPFIPVVDGTFLTETPQSSLERHAFKPTSVMLGTNKDEGPFFIIYYV
PEFRYDNESLIDRSVYKKAIDIGFKHLNKFGRDAVAFRYINWWDTNEGAMLRDGFSNMIG
DENIHCPAQEFAYSYATGQEDVYLYYFTQRASNSLFHPWMGVLHGDEIAYVFGLPLHEQG
NYSTGDIAVSRHVMRSWANFAKTGNPNKSSLDEVVEEKWQKYTPSEKHNFVISAATLPDG
EPNSRGSRLDYCAFWREYIPNLVTTTADIKEEEQKWKEEFHRWSTKYMVDWKAEFNHYVT
NRGQGCDADVNE
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggtttcctgtgcattattcgcgtgtatatatatatctctaatgctaaattatagtgcc
caagctgacgaagattatgattacgtggtatctactatgtacggcaaggtccgtggatat
cgcatacaagttacagagaaatatgtagatcaatatttgggtatcccgtatgccacgcca
cccgtcgacgaattacgttttaaaccaaccacacctcatcaaccatggaaaggcacgttg
aatggtacacggtatggtaaagggtgtatgcagttaccagatactcaattcggcgatttt
gaaggtactaatatgtggaatcctaatgtcttacttgatgaagattgtctgtatcttaat
gtgtggacaccacatccaagaccaactaatgctgcagttatggtttggatttatggaggc
ggatttgtagctggtgtagcctcattggaagtatatcatggagctacccttgctgccaca
gagggaaccatcgtggtgtcgttcaactaccgcgttgcatcattgggattcttctacctg
ggtcacgaggacgcgcctggcaatatcggactgctagaccaagtattagctttgcagtgg
gttcaagacaatatcattcattttggtggcgatcctactagagttacaatattcggagaa
agtgctggatctgttagtgttggattgcatctgctctcacctgtgagtcgcaatttgttt
gcgcgagctatccttcaaagtggaacacctaataatccctgggccactgtgacggcagac
gaagctcggcgtagaagtctaaaattatccaaagaattaggatgttataatgaacatagt
atgaccaataatgaagacattgctttgtgtatgcgaaggcaggatgcacgagatttaata
agcagtgaatggtttgacgatatgcatggcatttatcgttttccatttataccagttgtt
gatgggacgttcctcacagaaacaccccaatcgtcattagaaagacatgcattcaaacct
acctctgtcatgcttgggaccaataaagacgaaggaccatttttcatcatttattatgta
ccagagtttcgttatgacaatgagagcttaattgatcgatctgtttataaaaaggctata
gacattggttttaaacatctgaacaaatttgggcgtgatgctgttgctttcaggtacatc
aactggtgggacactaatgaaggtgctatgttacgtgatggattcagtaatatgattggt
gatgaaaacattcattgtcctgcccaagagtttgcatattcatatgccactggccaggag
gatgtgtatttatattatttcacacaacgtgcatccaatagtttgtttcatccatggatg
ggagtgctacacggtgatgaaattgcatatgtatttggactgccacttcatgaacaaggt
aattactcaactggggatattgctgtcagtcgtcacgtcatgagaagctgggctaacttt
gccaaaactggaaatcctaataaatcttcattggacgaggtggtagaagaaaagtggcag
aaatacacaccgtcagaaaaacacaattttgtgataagtgcggcaaccctcccagatgga
gaaccaaactcaagaggttcacgactggattactgtgcattttggagagaatatattcct
aatttagttacaactactgctgatattaaagaagaagagcaaaaatggaaagaggaattc
catcgatggagcactaaatatatggtggactggaaagcagaatttaaccattatgttact
aaccggggacaaggatgtgatgcggatgtcaacgaatga

KEGG   Saccoglossus kowalevskii (acorn worm): 100371748Help
Entry
100371748         CDS       T04123                                 

Definition
(RefSeq) acetylcholinesterase-like
  KO
K01049  acetylcholinesterase [EC:3.1.1.7]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100371748
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sko00537]
    100371748
Enzymes [BR:sko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     100371748
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sko00537]
 Enzymes
  100371748
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3 DUF1749 Peptidase_S9
Motif
Other DBs
NCBI-GeneID: 100371748
NCBI-ProteinID: XP_006825278
Position
Un
AA seq 602 aa AA seqDB search
MGAVAGNRIRILEETVHSFKGIPYAEPPIGELRFKNPLPLQHPWSGIRNATTFGNACWQQ
SDTMFLTAATDLTPSETLSEDCLYLNIWTPESAHNAAVMLWFHGGSFFWGAGSISLYNGG
TLAAVEKVVVVTVNYRLGAFGFLTLKHTDIRGNMGMMDQVLAIEWVKENIRYFGGDPDKI
TLVGQSAGGASVTYHLLSHVGRNNFRRAIVQSGTSNSPALDPKTMDETNHYAQLLSADLG
CVESIIPLNITTSLHDLPTPADPIDYSIYEENYESSSEVTLGEIDQYFENHATEVIACLR
TREPIDFVTSLWSFGLHFPTIDDAFIRETPADSINGEDFKRTELLIGMNENEAAVNLLRM
NWLPRENDSVIDASLFHQRIQDFYRRDQNDNILAETTAFMYRDWYDKHNPEKLRDAYEDI
VGDHDIKCPSIEFARTYSASDSTQVYMYQYTHRPSLSSWPEWMGCVHGDELAFVFGHPLH
MENGYTEEESNFSRKIMKYWANFAKTGNPNVDDPASDHHGNQWTRYGLDNLAYLTLNMSI
LNKTILSRGLRVPYCDFWRELVPKVTEGESTPKDTDKVRISTFSATTRRSFENVGSKFGT
FT
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgggggcagtggctggaaatcgcatccgaatactggaagagactgttcacagctttaaa
ggtattccttacgccgaacctccgattggagagttgcgattcaagaatccgttgcctttg
cagcatccctggtcgggtatcagaaatgcaacgacttttggtaatgcatgttggcagcag
tctgacactatgtttttgacagcggccacagatttgacaccgtctgaaacactgagcgaa
gattgcctgtatttgaatatctggacccccgagtcggcacacaacgcggcagtgatgcta
tggtttcacggggggagttttttctggggagctggatcgatctccttgtacaacggtgga
actctggctgctgtagagaaagttgtcgtcgtcactgttaattacaggttaggtgcattt
gggtttttgacattaaaacacaccgatatacggggtaatatgggcatgatggaccaggtt
ttagcaattgaatgggtgaaagaaaatatccgttattttggtggggatccggataaaatt
actctggttggacaaagcgcgggtggggccagtgtgacgtatcatcttctttctcacgtc
ggtaggaataacttccgtcgggccattgtacaaagtggaacttctaacagtcccgctctg
gatcctaaaaccatggatgaaacgaatcattatgctcaacttctgtctgctgatctgggc
tgcgtggagtctataatacctctaaatatcaccacctcactgcatgacttgccgacacct
gccgaccccattgattacagtatatatgaagaaaactacgagtcctcgagcgaggtgact
cttggtgagatcgatcagtattttgaaaatcatgccacggaagtcattgcatgtctgcgt
accagggagcccatcgacttcgtaacaagtctatggtcattcggtttgcactttccgaca
atagatgacgcgttcattcgtgagacaccagccgattcgatcaatggagaagacttcaaa
cggactgaattgctgataggtatgaatgaaaacgaagccgcagtgaatcttcttcgaatg
aattggttgcccagagaaaacgactctgtgatagacgcatctctatttcatcaacgcata
caagatttttaccggcgtgaccaaaacgataacattcttgctgaaacaactgcgtttatg
taccgagactggtacgacaaacacaaccctgagaaactacgagatgcatatgaagatata
gtgggcgaccatgacatcaaatgtccgtctatagaatttgccaggacgtattccgcgtcg
gatagtacgcaagtttacatgtaccagtatacacaccgcccatccctgtcttcctggccc
gagtggatggggtgtgtacacggggacgagttggcgtttgtgtttggtcatccgttgcat
atggagaatggatacacagaagaagaaagtaatttcagtcgaaaaattatgaaatattgg
gcaaattttgccaaaacaggcaatcctaacgttgatgatcctgcaagtgatcaccatggt
aaccagtggactcgttacgggttggacaatcttgcatatctcacactaaacatgtccata
ctgaataaaacaatattaagccgagggttgcgtgtcccttattgtgatttctggcgagaa
ctggtaccaaaggtaacagaaggagaatccacgcccaaggacactgataaggtacgaatc
tcaacattctcagcaacaaccagacgatcatttgagaatgtcggatcaaagttcggaaca
tttacgtaa

KEGG   Saccoglossus kowalevskii (acorn worm): 100372104Help
Entry
100372104         CDS       T04123                                 

Definition
(RefSeq) acetylcholinesterase-like
  KO
K01049  acetylcholinesterase [EC:3.1.1.7]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100372104
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sko00537]
    100372104
Enzymes [BR:sko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     100372104
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sko00537]
 Enzymes
  100372104
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3 Peptidase_S9
Motif
Other DBs
NCBI-GeneID: 100372104
NCBI-ProteinID: XP_006825360
Position
Un
AA seq 586 aa AA seqDB search
MLSLSTVFVVIVLITTACNADRPTVEISTGTLIGTVEEFSSEFVDGTRTVHVYRGIPYAE
PPVGDLRFAPPKPKTPWQGEYDAADFRTACIQPETPPIPTDKIQDEDCLHLNVYAPQPRK
DNTPVMFWIHGGAFIMGSGTRMYDATILSSLNDVIVVTINYRLGALGFLSTGDDVAPGNY
GFLDQVEALRWVQQNIAAFGGDPNTVTLFGESAGAMSAHYHVMSPMSKGLFKRSILQSGT
GVINGVLHTDTSKTNKIAHGQGKLVGCEKDNSKELIECLRTVPADEFRDSSDVTKRTIAN
VTGINDITMPFQPTLDGEFIKEDPSTIRTFNGEELMTGTTGDEGLFFFFSLFPNDDSELS
VNKTLYDSMFSMVIPGKNQAVLDMIKLIYVDWDHADEENANYLSPLSQMAGDVFFVCPSD
VAARDYYGAGLNTYMYQLTHAPAKSVWPFKTGKPLHGDDILFVFGYALLSEMQLVLGGDE
KTLYKQTPNEIDIQVSLQTMKYWTNFAKTGNPNRSSASDEDNNDDWPLFTVPGLAYKQLS
LSMENSNALKARECAFWNQFEPKLQKFGETCGAKEESKYSEEANTP
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgttgtccttatcgactgttttcgttgtaatcgtgctgattaccactgcctgtaatgca
gacagaccaactgtcgagatctctaccggtacactaatcggtaccgtggaagaattcagc
agtgaatttgtagatggtacacggactgtacatgtctataggggtataccgtacgctgaa
ccaccggtcggtgacctgaggtttgcaccgcctaaacccaagacaccgtggcaaggggag
tacgatgctgccgacttccgtactgcgtgcatacaaccggaaactccgccgattcccacg
gacaagatacaagacgaagactgcctgcatttgaatgtttatgcaccacagccacggaaa
gacaacacgcctgtaatgttctggatccacggaggtgcatttattatgggatccggaacg
aggatgtacgatgcaaccatactgtcttcattgaatgacgtcattgtagtcaccattaat
tatcgactgggggcgcttggatttctcagcacaggtgatgacgtagcacccggtaactat
ggtttcttagatcaagtagaagcacttcgttgggttcaacagaacattgcagcttttggc
ggagatccaaacaccgttaccttatttggcgagagcgcgggcgccatgagtgcgcattac
cacgtgatgtctccaatgagtaaagggttgttcaaaagatctattctccagagtggtacc
ggcgtaataaatggggttctacataccgatacatctaagactaacaagatagcacatggt
cagggtaaacttgttggatgtgagaaagacaacagtaaagagctaattgaatgtcttcgt
actgtaccagcagacgagtttagagattcgtctgacgtcacaaagcgcactatagcgaac
gtgacaggaattaatgatatcacgatgccatttcaaccgactttggatggagaatttata
aaggaggacccttcgacgatcagaacttttaatggcgaggaattgatgactggtactacg
ggcgatgaaggattgttctttttcttctcattatttcctaacgatgacagtgagttatca
gttaacaagactctgtatgattcgatgtttagcatggttattccaggaaagaaccaagct
gtcttagacatgattaaactaatttacgtggactgggaccacgctgatgaggagaatgcc
aactacctgtcacctttgagtcaaatggcaggagacgtattttttgtttgtccatctgac
gtagctgcccgtgattattacggtgcgggactcaatacctatatgtaccagttgacacac
gccccggcgaagtcagtctggcctttcaaaactggcaagccacttcatggagatgatatt
ctatttgtctttggttacgccctgctatctgagatgcagctagttcttggtggtgacgag
aagacattatataagcagacgccaaatgaaattgatattcaggtgtctttacaaactatg
aaatactggacgaattttgccaaaactggtaatcctaatcgtagttctgcaagtgatgaa
gataacaacgatgactggccattgtttacagtgccaggtttagcgtataaacaactctca
ttatcaatggagaatagtaatgcattgaaagcaagagaatgtgcattttggaatcagttt
gaaccaaagcttcagaaatttggtgagacatgcggcgcgaaagaagaatctaaatactcg
gaagaagcaaacacgccttag

KEGG   Saccoglossus kowalevskii (acorn worm): 100372871Help
Entry
100372871         CDS       T04123                                 

Definition
(RefSeq) acetylcholinesterase-like
  KO
K01049  acetylcholinesterase [EC:3.1.1.7]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100372871
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sko00537]
    100372871
Enzymes [BR:sko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     100372871
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sko00537]
 Enzymes
  100372871
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase
Motif
Other DBs
NCBI-GeneID: 100372871
NCBI-ProteinID: XP_002734561
Position
Un
AA seq 397 aa AA seqDB search
FGGDPSRVTIFGESAGAGSTHIHTISPLSKGLFKRAIMQSGAATIDGMWQYNKTLSNLIA
HGVGKIVGCDKDTSKDLIDCIRNVPADQLRNISDPSNGLLADALEMPGVQLAFLPTIDGF
LIKEDPMDTFFKTKTFNDVDVMFGTVSDEGMIFLFSLFSDAENEGPLILNKTTYDAMYPN
FLFTIQPNEAVLDTIKLLYVDWAHVDEENANYLDALSQMASDIFFVCPINRAARASAEAG
LNTYVYQMTHVPAMTIWPLKTDTAVHGDELGFVFGYHMLSEKQMALGGDNTTMFKWTTSE
VDAELSLQIMKYWTNFAKTGNPNLSSLSDESNDDDWPMFTIPGLAYRELSPSMVNRYALK
ARECVFWDEFVPKLLQPSGESCDKKEESKYSEEVNQP
NT seq 1196 nt NT seq  +upstreamnt  +downstreamnt
cattcggcggtgatccttccagagttactatatttggtgagagtgctggcgccggaagta
cgcatattcacaccatatctcctctaagtaaaggattgtttaagagagctattatgcaga
gtggtgctgcaaccatagatggaatgtggcaatataataaaacgttgtctaacctgattg
cccatggtgttggcaaaattgttggatgtgacaaggatacttccaaggatttaattgact
gtattcgtaatgtaccagctgaccagttaagaaatatatcagatccatcaaatggtttac
tcgcagatgcacttgaaatgcctggagttcaacttgcctttcttcctacaattgatggat
ttttaattaaggaggatcccatggataccttttttaaaactaaaacattcaatgatgtgg
atgtgatgtttggcacagtctctgatgaaggaatgatcttccttttttcccttttttctg
atgcagaaaatgaaggtcctctgatattaaacaagactacatacgatgcaatgtatccca
attttctttttactatacagccaaatgaagcagtgttagatacaattaaactactgtacg
ttgactgggctcatgttgatgaagaaaacgccaattatttagatgcattaagccagatgg
caagcgatatcttctttgtatgtcccataaaccgtgcagcacgtgctagtgctgaagccg
gactcaatacatacgtatatcaaatgacacatgtacctgcaatgacaatatggcctttga
aaactgacacagccgtgcatggtgatgaactaggatttgtttttggttatcacatgcttt
ccgagaaacagatggcgcttggcggtgataacacaaccatgtttaaatggactacaagtg
aagtagatgccgagctgtctttacaaatcatgaaatactggactaattttgctaaaactg
gtaatcctaatctcagttcactgagtgacgaatcaaatgacgatgactggccaatgttca
ccatacctggtttagcatatagagagttatcaccatccatggtgaatcgttatgcattaa
aggcgagagaatgtgtattctgggatgaatttgtaccaaaacttctgcagccttctggtg
agtcatgtgacaagaaagaggagtctaaatactccgaagaagtcaaccaaccgtga

KEGG   Saccoglossus kowalevskii (acorn worm): 100373345Help
Entry
100373345         CDS       T04123                                 

Definition
(RefSeq) acetylcholinesterase-like
  KO
K01049  acetylcholinesterase [EC:3.1.1.7]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100373345
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sko00537]
    100373345
Enzymes [BR:sko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     100373345
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sko00537]
 Enzymes
  100373345
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3 AChE_tetra Peptidase_S9
Motif
Other DBs
NCBI-GeneID: 100373345
NCBI-ProteinID: XP_002730483
Position
Un
AA seq 601 aa AA seqDB search
MADVHILSFILLCCVAINFALSSNDVNDDDLLITLSGNSVIRGKRETVLDKVVDAYLGIP
YGKAPIAELRFKAPLKVDDWDGVLDTTQYGNACYGWIDNYYGNFSGTQMWNSKQPLSEDC
LNLNVWTTHPRPENAAVMVWIYGGGFYSGTSGLDVYNGKYLAAEEGVIVVSLNYRLGPLG
FLYLHEHTPGNMGLLDQVLALQWVQDNIINFGGDPTRVTIFGESAGSVSVGMHLLSPLSR
DLFNYAILESGTPNNPWASVSLELATDRASRLALAVGCYNGDFSIMLSCLRQVGPQELVN
NQWEDYGVYVFPFVPVVDGTFLTETPQSSLDRHSFKNTSILIGSNLNEGNFFLIYGTSGF
NAFTDSLLNHSLYQQATKESFQDYNQFGLDAISFQYIDWMDPDNDTMLRNAVDAMVGDYN
IICPANQFATSYARVQQTVYKYYFTQVSSNSPWRDWLGSLHGDEIAYVFGIPLDISTGFS
TQEIQLSRKIMKYWTNFAKTGNPNTGDEWPVYTPTSKEYLILNTDSLDDVKVGIGLRANK
CGFWDYYLPNLNIQTADIEEAEKRWKEEFHQWSTKYMGDWKTEFQTYVTYKGQVCSAIND
P
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atggcggatgtacacattctctctttcattcttttatgttgtgttgccattaactttgcg
ctatctagcaatgacgtcaatgatgacgatttattgattaccctgagtggaaattcggtt
attcgtggtaaacgcgagacagtgttggacaaggtagtcgacgcgtatcttggcattccg
tacggtaaagcacctatagcggagttacgattcaaagctcctctcaaagttgatgactgg
gatggggtacttgacacaactcagtatggaaacgcttgctatggatggattgacaactac
tatggtaatttctcgggaacacagatgtggaattctaaacaacctctaagcgaagattgt
ctgaatttaaatgtatggacaacacatccaagacctgaaaatgccgctgtgatggtttgg
atatacggcggcggtttttacagtggtacttcggggctggatgtgtataatggaaagtac
ttagctgcagaagaaggtgtgattgtggtttctctcaattatcgtctgggcccattaggg
tttctatacctgcatgaacacacaccaggaaacatggggttgctagaccaagtgctagct
ttgcagtgggttcaagacaatatcattaattttggtggcgaccctactagagttacaata
ttcggagaaagcgctggatccgttagtgttggaatgcatctattatcgccattaagtcgt
gatttgttcaactatgctatattagaaagtggaacaccgaacaacccgtgggcgtctgtt
agtctggaattagcaacggatcgagccagtcgtttagcactcgccgttggatgttacaat
ggcgattttagcataatgctatcttgtctacgccaggttggcccacaagaacttgttaat
aatcaatgggaggattatggcgtttatgtgttcccatttgtaccagtggtagacggcacg
ttccttactgaaactccgcaatcatctttagacagacactcttttaaaaacacctctatt
ttgattggatcgaatctcaacgaaggaaatttctttttgatctacggtaccagtggcttt
aacgcattcactgacagtttgttaaaccactcactgtaccagcaagcaacaaaggaaagc
tttcaagattacaatcagttcggccttgacgccatatcatttcagtacattgattggatg
gatccagataatgacacaatgttacgtaatgcggtggatgcgatggttggtgattataat
attatatgccctgccaaccaattcgcaacgtcgtatgctcgagttcagcaaactgtttat
aaatattattttactcaagtgtcatccaactccccctggcgtgattggttgggcagtctc
catggtgatgagatcgcctatgtttttggtattcctttggatataagtactggattctcg
acacaagaaatacaacttagtagaaaaatcatgaaatattggacgaatttcgccaaaaca
ggtaaccccaatacaggcgatgagtggccagtatatacgccgactagtaaagagtattta
attctaaacaccgattctttagacgatgttaaagttggtataggtctccgtgcaaataaa
tgtggattctgggactattatttacccaacctcaatattcaaacagctgacattgaagag
gctgagaaacggtggaaagaagagtttcatcaatggagcaccaaatatatgggcgactgg
aaaaccgaattccaaacatatgtcacgtataaaggtcaagtctgtagcgctattaatgat
ccgtag

KEGG   Saccoglossus kowalevskii (acorn worm): 100375314Help
Entry
100375314         CDS       T04123                                 

Definition
(RefSeq) crystal protein-like
  KO
K01049  acetylcholinesterase [EC:3.1.1.7]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100375314
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sko00537]
    100375314
Enzymes [BR:sko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     100375314
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sko00537]
 Enzymes
  100375314
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3 Chlorophyllase2 PAD Peptidase_S9
Motif
Other DBs
NCBI-GeneID: 100375314
NCBI-ProteinID: XP_002733219
Position
Un
AA seq 517 aa AA seqDB search
MVKVFFGIPYASPPIGDNRWCPPKPAKPWAPSVLQATKPPPGCYQHCDLPPYTCPDSVSE
DCLYLTVFTPLTAVNGSKFPVMMFIHGGNFITGSGYTELTDGRFMSNYTNTVTVFINYRL
GAFGFLVAGTKSDAAIGNYGIMDQRAAMDWIQSNIEAFGGDPDKVTIFGQSAGSQSVAIH
LATDKSKHLFHRAIIESFPYSVPFKTPWEAVILGNDLADDLNCTHGDMKCLRSASPESVY
AAQGQSGGVIINPLRLLEEFEPWGPVVDGKDITKQSVDSFMKGEYQDKPIMMGTTSDEAR
IYIFGAFPDPANIIQVYEFVLAVFPTHFFKVIEEYPPGPPGSDQREPLSTAAHHFVFACP
TRAALRGVARHGNNKVWMYLYDHVMSFHKAWGPSWESMCTTHVCHGAELPFVFHTATNGG
YNYTPDELVLTDTMLYYWTNFAHTGNPNNGQTKKSATSYVHNRLQNWPEYSNSSNWSYMH
FTTPSRVDKDYLSKKCDFWDTLDVYSRKYRILHKSCQ
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggttaaggtgttcttcgggataccatacgcctcaccaccaataggtgataaccgctgg
tgtccaccgaaaccagctaaaccctgggctccgtcagtattacaggcaacaaaaccacca
cctggatgttaccagcattgcgatttaccgccatatacatgtccagactcggtcagtgaa
gactgtttgtatttgacagtttttactccgctgaccgctgtcaatgggtcaaagttccca
gtgatgatgtttatacacggaggaaacttcataactggaagtggatacacggagctgaca
gatgggcggttcatgtcgaattatactaacacagttactgtgtttatcaactacagatta
ggagcgtttggatttttggttgctggtaccaaaagtgacgctgctattggtaactatggc
atcatggatcaacgtgcggcgatggattggatccagtctaacatcgaggcatttggtgga
gaccccgataaggttacaatatttggtcaaagtgcaggatctcaatcagtcgccattcac
ttagctacggacaagagcaaacacctttttcatcgcgccatcatagagagtttcccatat
tcagtgcccttcaagacaccctgggaggcagtcattcttggaaatgacctcgcagacgat
cttaactgcacacatggtgatatgaagtgtcttcgatctgcgtcaccagaaagtgtctac
gcagcacagggccaaagtggaggagtgatcataaatccgttacgtttgctagaagaattc
gaaccatggggccctgtcgttgatggtaaagacattacaaaacaatcagtggattcgttc
atgaaaggagaataccaagataaaccgataatgatgggaaccacatctgacgaagccaga
atttatatatttggggcattccctgatccagcaaatattatacaggtatatgaattcgta
ctggcagtatttccaacacacttttttaaagtgatagaagagtatccgccggggcctccg
ggcagcgaccaaagagagccgctctcgactgctgcccaccatttcgtatttgcctgtcct
acacgcgctgctttacgcggagtcgccaggcacggtaacaacaaagtgtggatgtatctg
tatgaccacgtgatgtcattccacaaagcttggggaccatcctgggagagcatgtgtacc
actcatgtatgtcatggtgccgaactaccgtttgttttccatacagctactaacggcggt
tataattatacaccagatgaactcgttttaaccgataccatgctatactactggaccaac
tttgcgcataccggtaatccaaacaacggacaaactaaaaagagcgccaccagctatgtt
cacaatagattacaaaactggccagaatactcaaattcaagtaattggagttacatgcat
tttacgacaccgagtcgtgttgataaagattacctgagcaaaaagtgtgatttctgggat
acactggatgtatattcccgaaaatatcgcattcttcataagtcttgtcagtga

KEGG   Saccoglossus kowalevskii (acorn worm): 100377611Help
Entry
100377611         CDS       T04123                                 

Definition
(RefSeq) acetylcholinesterase-like
  KO
K01049  acetylcholinesterase [EC:3.1.1.7]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100377611
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sko00537]
    100377611
Enzymes [BR:sko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     100377611
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sko00537]
 Enzymes
  100377611
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3
Motif
Other DBs
NCBI-GeneID: 100377611
NCBI-ProteinID: XP_002732249
Position
Un
AA seq 361 aa AA seqDB search
MYDQVLALKWVKSNIGAFGGDPNMVTIFGESAGAASVGLHLLSPLSEPLFNRAILQSGAP
DANWAVMTHAQSRQRSETLGLSHGCDDFEDRDFVDCLRCIPADTLSANEWVTGNFNEFPW
VPVVDNKFLTDEPKRLIRNGHFKKASIMAGVNGDEGTYFILYQIPGYEIDTPSYQTYDNY
LGNVDVVNYDLNMCSRSAIKDHYSHWNMLYDSVANRDALDDVVGDRQFICPTVDFAHKYA
QENVNVYTYKLDIRDSQNPWPQWMGIMHGDDIQFVFGMPLNPANGYTDEEVELSENIMAY
WANFAKSGNPNKGQLVPYWPRQTAQGRQYLRFPTFESDSGLRKEDCQLWSELIPLLERDE
R
NT seq 1085 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaccaagttcttgccttgaaatgggtgaaatctaacattggtgcttttggagga
gatcccaacatggtgaccatttttggagaaagcgctggagcagcaagtgtaggcctacat
ctactttcaccattgagtgagccattattcaatcgcgccatattgcagagtggtgcgcct
gatgccaactgggcagtaatgactcatgcacagtccaggcagagatctgaaactctaggc
ctatctcatggctgtgatgatttcgaagatagggacttcgtcgattgtcttcgttgtatt
cctgctgatacattgagtgctaacgaatgggtaactggtaattttaacgagttcccatgg
gttcccgtcgttgataacaagtttctaacggacgaaccaaaaaggttgattcgcaacggc
cacttcaagaaagccagtatcatggcaggcgttaatggagatgaaggcacgtattttatt
ctgtaccaaataccaggatatgaaatagacacacccagttatcagacatatgataactac
ctaggcaacgttgatgttgtgaactatgatttgaatatgtgttcaagatctgccatcaaa
gaccactactctcactggaatatgctctacgacagtgtggctaaccgtgatgccttagac
gatgtcgttggcgaccgtcagttcatatgtccaacagttgattttgctcataaatacgcg
caggaaaatgtaaacgtgtacacatataagctggatatcagagacagtcagaatccatgg
ccacaatggatggggataatgcatggtgatgatatccagttcgtttttggcatgcccctg
aatcctgcaaacgggtatactgatgaagaggttgaattatcggaaaacataatggcttat
tgggcgaatttcgctaaatcagggaatccaaacaagggacagttagtaccatattggcca
cggcagacggcacagggacgtcagtacctaaggtttcccacctttgaatctgattctgga
ctacgaaaagaagattgtcaactgtggagtgaattaataccactattggaaagagacgag
agatg

KEGG   Saccoglossus kowalevskii (acorn worm): 100378042Help
Entry
100378042         CDS       T04123                                 

Definition
(RefSeq) acetylcholinesterase-like
  KO
K01049  acetylcholinesterase [EC:3.1.1.7]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100378042
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sko00537]
    100378042
Enzymes [BR:sko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     100378042
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sko00537]
 Enzymes
  100378042
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3
Motif
Other DBs
NCBI-GeneID: 100378042
NCBI-ProteinID: XP_006824380
Position
Un
AA seq 475 aa AA seqDB search
AQNKLLYMCGLTQFDIDIVQAFSNGRTPGIDGLECSDLHEVFFQSCWRLDVLMLLAGCCI
LSQGSLARQDPLELRIKSGVVRGKIVSLPDNRGEAFAFLGIPFAEPPVENLRFREPVPIS
KWSGVYDATNFGNSCMQKLDMLYPDFPGAEMWNPNTQVSEDCLYLNVWTPSPKPHKAAVM
VGNYGMYDQVLALKWMKSNIGTFGGDPNRVTIFGESTGAASVGLHLLSPLSEPLFNRAIL
QSGTPDAEWAVMTHGGAETKSQILGSFHGCNFSQSDFVDCLRNVSADELSARERQFSEMP
WTPIADGKYLLYDPKHSDEGRYFILYGFVPGYEKDSTNLQTYENYLANVDYTNSDLNTCS
RAAIKDHYTHWESPHDAVVNRDNLGDVIDDRLLICPTVNFAHKYAQTNVNVYSYQYNIRD
SQNPWPEWMAVIHGDEIQFVFGIPLNPANEFTEKEVRYSEKIMAYWTNFAKSGVT
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
gctcaaaataaacttctgtacatgtgtggtttgactcagtttgatattgacatcgtacaa
gctttctcaaatggaagaacacctggtattgacggactagaatgttctgatttacacgag
gtgttttttcagtcatgttggagactagatgtccttatgttgttggctggttgctgcatt
ctttcccaaggttcactagctcggcaagaccctctcgagctcaggattaaaagtggtgta
gttcgtggcaagattgtgagtttgcctgataaccgaggcgaagcgtttgctttcctagga
ataccttttgccgagcctccagttgaaaatcttcgttttcgtgagcctgtaccaatatca
aagtggagcggtgtttatgatgctactaattttggaaattcttgcatgcagaaactagac
atgttgtatcctgattttccaggcgctgaaatgtggaaccccaatacacaagttagtgaa
gactgcttgtacttgaatgtgtggactccatcaccaaaacctcataaagcggccgtcatg
gtaggaaactatggaatgtatgaccaagttcttgccttaaaatggatgaaatctaacatt
ggtacttttggaggagacccaaacagggtcactatctttggagaaagcactggagcagca
agtgtaggtctacatctactatcaccattgagtgaaccattattcaatcgcgccatattg
cagagtggtacacctgatgccgagtgggctgtgatgacccatggcggggccgagacgaaa
tctcaaattcttggttcatttcacgggtgcaatttctctcaaagtgactttgtggattgc
cttcgcaatgttagtgccgatgaattgagtgcacgcgaaaggcagttttccgaaatgcca
tggacccccatcgctgatgggaagtatttactgtacgatcctaaacactcggatgaagga
aggtattttattttgtatggatttgtaccaggatatgaaaaagactccaccaacttacag
acatatgaaaactatttagccaatgtagattataccaactctgatttgaatacttgttcc
agggcagctattaaagaccactacacacactgggaatcgccccatgatgctgttgttaac
cgcgataacttaggtgatgtgattgatgaccgactactcatatgtccaacagtaaatttt
gctcataaatatgcacagacaaatgtaaacgtgtattcgtaccagtataatatcagagac
agtcagaatccatggccagaatggatggcagtcattcatggtgatgaaattcagtttgtg
tttggtatacccttaaatcccgcaaatgaatttactgagaaagaggttcgatattcggaa
aaaataatggcttattggacgaacttcgctaaatcaggagtcacgtga

KEGG   Saccoglossus kowalevskii (acorn worm): 102803221Help
Entry
102803221         CDS       T04123                                 

Definition
(RefSeq) acetylcholinesterase-like
  KO
K01049  acetylcholinesterase [EC:3.1.1.7]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102803221
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sko00537]
    102803221
Enzymes [BR:sko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     102803221
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sko00537]
 Enzymes
  102803221
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3
Motif
Other DBs
NCBI-GeneID: 102803221
NCBI-ProteinID: XP_006825361
Position
Un
AA seq 464 aa AA seqDB search
MVWIHGGAFIIGSGTRLYDATILSSLNDVIVVTINYRLGALGFFSTGDDVAPGNYGFLDQ
VEALGWVQQNIAAFGGDPNTVTLFGQSAGAISIHYHVLSPMSKGLFKRTILQSGTATIKG
FMAQSDDASRTNIIANGLGKFVGCEKDNSKELLECLRAVPADEFRDAFYVTKLAIANMTK
IKDMMIPFPPTLDGEFVKEDPLNTETKFNGEELMIGATTDEGFMMYLPLFPVHDSEFTVN
KTMYEAMYSMLISDKNQAVLDAVKLIYVDWDHADEEDANYLSALCQMAGDMMFVCPSDLA
ARAHSAQGINTYLYQMTHVPATTLWPVKTGTSLHADDIQFVFGYPLLSEMQLVLGGNEKT
LFKQTPNENDIQVSLQTMKYWTNFAKTGNPNRSSASDDDNNDDWPLFTVPGLAYKQLSLS
MENSNALKARECAFWNQFVKKLQQSGDTCVNKEESKYSEEANSP
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggtatggatccacggaggagccttcattataggatccggaacgaggctgtacgatgca
accatactgtcttcattgaatgacgtcattgtagtcaccattaattatcgattgggggcg
cttggatttttcagcacaggtgatgacgtagcacccggtaactatggtttcttagatcaa
gtagaagcactcggttgggtgcaacagaacattgcagcttttggaggagatccaaatact
gttacattatttggccaaagtgcgggtgccataagtatacattatcacgtgttatctcca
atgagtaaagggttgttcaaacgaactattctgcagagtggcacggccacaataaaggga
tttatggcgcaatccgatgatgcatctaggactaatataatagcgaatggccttggtaaa
tttgttggatgtgaaaaagacaacagtaaagagttacttgaatgtcttcgtgctgtacca
gcggacgagtttagagatgcgttttacgtcacaaagctcgccattgccaacatgaccaaa
attaaagatatgatgataccatttccacccactttggatggagaatttgtaaaggaggat
cctttgaacacagagacgaaattcaatggcgaggaactgatgattggtgccacgactgat
gaaggattcatgatgtaccttccattatttccggttcatgacagcgagttcactgtgaac
aagactatgtatgaggcgatgtattccatgcttatttcagataagaaccaagctgtttta
gacgcagttaaactgatttacgttgactgggaccacgctgatgaggaagatgccaactac
ctctcagcgttatgtcagatggcaggggatatgatgttcgtttgtccaagtgacttagct
gcacgtgctcattccgcacaaggaattaacacgtatttgtaccagatgacgcacgtacca
gcaactacattatggcctgtcaaaactggtacatcactgcatgcagatgacatccaattc
gtctttggttaccctctgctatccgagatgcagctagttcttggtggtaacgagaagact
ttatttaagcagacgccaaatgaaaatgatattcaggtgtctttacaaactatgaagtac
tggacgaattttgctaaaactggtaatcctaatcgtagttctgcaagtgatgacgataac
aacgatgactggccattgtttacagtgcctggtttagcgtataaacaactctcattatca
atggagaatagtaatgcattgaaagcaagagaatgtgcattctggaatcaatttgtaaaa
aagcttcagcaatccggtgatacatgtgtcaacaaagaagaatctaaatactccgaagaa
gcaaacagtccttag

KEGG   Saccoglossus kowalevskii (acorn worm): 102804052Help
Entry
102804052         CDS       T04123                                 

Definition
(RefSeq) cAMP-regulated D2 protein-like
  KO
K01049  acetylcholinesterase [EC:3.1.1.7]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102804052
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sko00537]
    102804052
Enzymes [BR:sko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     102804052
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sko00537]
 Enzymes
  102804052
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3
Motif
Other DBs
NCBI-GeneID: 102804052
NCBI-ProteinID: XP_006817907
Position
Un
AA seq 493 aa AA seqDB search
MVLSSDSISDEALVVNTSYGKVRGVYVEHARVFFGVPYAAPPTGKYRWSPPHRHVGWFPG
IYNATEDPPGCIQKCTNFLANSCPNKTSEDCLSLTIFTPLTATPTSMLAVMVYIHGGSFI
ERSGYTLIQDGRYIANHTNTITVFINYRLGALGFLPIVDESSPNGNYGIFDQRFALEWVK
DNIVAFGGDSSMVTIVGQSVGAQSVAIHLTTPRSQQLFHRAIMESCPLGGIRFLTKREAQ
IQASDLMTYLGCINTNELECMRSKSADDILNAQYSIIQNQKLMDYTQPWGPYLDGNDIVK
QIAQSFLDDDYQNKPIIMGFVADDARDSLYRLFPQPMNETQFSGFFSKMMIGKSTDIFHP
SENNDYRDIASQLLLLYTFACPIKYISQHLSLANISIWNYVFDHPFSFDGWDPELTYCTN
YSCHCVELPFLFHSVTLIGLNYSNDEEILAYSLIQYWGLLKISLDPAVYMEEVVIVTSYL
MYVNLFIDYPGDE
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggtgttatcttcagatagcatttccgacgaggcgttagttgtgaatacttcttatggc
aaagtaaggggagtatatgttgaacacgcccgagtgttttttggggttccatatgctgct
cccccaactggaaaatatagatggagtccgccacatcgacacgtcggatggttcccaggt
atttacaacgccacagaagaccctccgggctgtattcagaagtgcaccaactttcttgct
aactcatgcccaaataagacgagtgaagattgtctttcattgactatttttaccccactg
accgctaccccaacatcaatgcttgctgtcatggtatatatacatggaggcagctttatt
gagcgcagtggatacaccttgattcaagatggacggtatattgccaaccatactaatact
atcactgtctttataaactatagactaggtgctcttggatttctgccgatagtagacgaa
agttcaccaaatggaaactatggtatattcgatcaaagatttgcattggaatgggtgaaa
gataacatagttgcctttggaggcgattctagcatggttaccattgttggacaaagcgtc
ggtgcacagtctgtagcaatacacttgaccacaccaagaagccagcaactatttcatcga
gctattatggaaagttgcccgcttggaggaatacgatttctcacaaaacgtgaagctcaa
attcaagccagtgatttaatgacataccttggatgcataaatacaaacgaactcgagtgt
atgagaagcaaatctgcagatgatatacttaacgcacaatacagcataatacaaaatcag
aagctgatggactatactcagccatggggaccctatctagatggcaatgacattgtaaag
cagattgcacaatcattcctggacgatgattaccaaaataaaccaattattatgggattt
gttgcagacgacgcaagagatagcctgtacagactatttccacaaccgatgaatgaaaca
caattcagtggttttttctccaaaatgatgataggcaaatccacggacatatttcaccct
tctgaaaataacgactacagggatattgcgtcacaacttttacttctctatacatttgca
tgcccaataaaatacatctcacagcatctctcgttggcaaacatatctatttggaactat
gtttttgatcaccccttcagttttgatggatgggaccctgagttaacatactgtacaaat
tactcttgtcattgtgttgaactaccatttctctttcattcagttacactcataggactg
aattattcaaatgatgaagagattcttgcctatagtctcatacaatattggggattactg
aaaatatcacttgacccggctgtgtacatggaagaagttgtgattgtaactagttactta
atgtatgtcaacttgttcattgactacccgggtgatgaatag

KEGG   Saccoglossus kowalevskii (acorn worm): 102805031Help
Entry
102805031         CDS       T04123                                 

Definition
(RefSeq) acetylcholinesterase-like
  KO
K01049  acetylcholinesterase [EC:3.1.1.7]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102805031
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sko00537]
    102805031
Enzymes [BR:sko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     102805031
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sko00537]
 Enzymes
  102805031
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase
Motif
Other DBs
NCBI-GeneID: 102805031
NCBI-ProteinID: XP_006813360
Position
Un
AA seq 316 aa AA seqDB search
MHMLSPLSKGLYKKVIAESGSSLNPWAVYIEPYDPTDAAYLLADNSGCPRLPHEDLLACL
RTMDPFLISAMTPIQLYNIFTWAPVVDGPGGFLPDEPLNLLKNGQFNMDVPVLIGYNKDE
TSPLMVLVDGAGDGMTRDEFNQLLWDRNVLGRKYYSDTNIHYEDLFKAYGNQYTPWEDPE
NVTLLRDAYMELLDENIFHAGIHWQARAFSIYGLDTYVYRFDYDRSGILPDWMGVPHVAE
LFYVFGSSYQDNAFAFMEWTDEDRKVSDTVQTLWCNFAKSGNPTPDGMAIPNRITVSTKY
FEPAKVTSDGRERSVA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcatatgttgtctccgttgtctaaaggtctttataagaaggtgattgcagaaagcgga
agttcattaaatccgtgggcagtttacattgaaccatatgatccaacagacgctgcttat
ttgttggccgataatagtggttgcccacggctaccccatgaagatttattagcttgtctg
agaaccatggacccctttctgattagtgcaatgacacccattcaactctataacatattc
acatgggcaccagttgtggacggacctggaggttttcttccggacgaaccgttaaattta
ctaaaaaatggtcagtttaatatggatgttcccgtactcattggttataataaagacgaa
acaagtccattaatggtacttgttgatggtgcgggggatggaatgacaagggatgaattc
aatcagttgctttgggacagaaacgttttggggaggaaatattattcagatacaaatatc
cattacgaagatttattcaaagcctatggcaatcaatacactccttgggaggacccagaa
aacgtaacattgctgagagatgcgtacatggagctcttggatgaaaatatcttccatgct
ggcatccattggcaagcaagagctttttcaatttatggattggacacgtatgtttatcgt
tttgattatgacagaagtggtattttaccggattggatgggtgttccacatgtagcggaa
ttgttttatgtattcggctcatcatatcaggataatgcgtttgcattcatggaatggacc
gatgaagacagaaaagtttctgatacagttcaaacgttatggtgtaattttgctaaatct
ggaaacccaaccccagatggcatggcaattccaaaccgcataacagtttcgacgaaatat
ttcgagcctgctaaagtgacgtcagatggcagggaacgaagtgtggcatga

DBGET integrated database retrieval system