KEGG   Saccoglossus kowalevskii (acorn worm): 100367289Help
Entry
100367289         CDS       T04123                                 

Definition
(RefSeq) monoglyceride lipase-like
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00561  Glycerolipid metabolism
sko01100  Metabolic pathways
Module
sko_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100367289
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sko01002]
    100367289
Enzymes [BR:sko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100367289
Peptidases [BR:sko01002]
 Serine Peptidases
  Family S33
   100367289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 Lipase_3 Esterase Abhydrolase_2 DLH Thioesterase Abhydrolase_5 DUF1057 LIDHydrolase DUF2974 FSH1 Tannase
Motif
Other DBs
NCBI-GeneID: 100367289
NCBI-ProteinID: XP_002740294
Position
Un
AA seq 304 aa AA seqDB search
MATSPQGVPYEQLAHYVNADGQCIFTRCWAPPTDIEIRALCLVLHGAAEHSGPYDRLAIP
LTGCGVMVYAHDHVGHGQSQGDQMDITDFNIYIRDTLQHVDVITSKHPNLPIFLFGHSLG
GAIAILTAMERPEQFTGVVMTGPAITVHKKLTSSLTMNLLRFTSYWFPKHELDKINPEHV
SRDPKEVELYRTDPLVWHGGLKARFVAKATAAFQQIQNNMSSIEWPFLILHGDADNLCDI
NGSKMLVERAKSTDKHLQVYPGHYHALICEPPKDAAVVIRDITSWIVRRIPENATKPDDV
HYRD
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggctaccagtccacagggtgtgccatatgaacagcttgcacattacgtgaacgctgac
ggacagtgtattttcactcggtgctgggctcctcccacggacatagaaatcagggcactg
tgtctggtattgcacggtgcagctgagcacagtggtccatacgatagactcgctataccc
ttgacaggatgtggtgttatggtatatgcacatgatcacgtcggtcatggtcagagtcaa
ggagatcaaatggatataacagatttcaacatctatataagggatactttacagcacgtt
gatgtgattacaagtaaacatccaaatttaccgatatttctcttcggccattctctgggc
ggtgcaatagccattctaacggctatggagagaccggagcagttcactggtgttgtaatg
acggggcccgctatcacggtacacaaaaaactgacttcttcactaacaatgaatttactg
agatttacatcatattggtttccgaaacacgaacttgacaaaataaacccagaacatgtc
agtagagatccaaaagaggtcgagctgtaccgaacagacccactggtttggcacggtgga
ctaaaagcaagattcgttgccaaggcgacggctgcctttcaacaaattcagaataatatg
tcttcgattgagtggcctttcttgatactacacggggatgcagacaacctgtgtgacatt
aatggttcgaagatgcttgtagagagagcaaagagtacagataaacatttacaggtatac
cctggtcattatcatgctttaatctgtgaacccccaaaagatgccgccgttgtgatcaga
gatataacatcatggattgtaagaagaattcccgagaatgcaaccaaaccagatgacgta
cattacagagattaa

DBGET integrated database retrieval system