KEGG   Saccoglossus kowalevskii (acorn worm): 100367442Help
Entry
100367442         CDS       T04123                                 

Definition
(RefSeq) monoglyceride lipase-like
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko00561  Glycerolipid metabolism
sko01100  Metabolic pathways
Module
sko_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:sko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100367442
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sko01002]
    100367442
Enzymes [BR:sko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100367442
Peptidases [BR:sko01002]
 Serine Peptidases
  Family S33
   100367442
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase Peptidase_S9 Lipase_3 Ser_hydrolase DLH PGAP1 Abhydrolase_5 Peptidase_S15 Abhydrolase_2 DUF2974 Abhydrolase_3 Chlorophyllase2 UPF0227 BAAT_C LIDHydrolase Thioesterase DNA_photolyase FSH1 DUF2920 DUF1350
Motif
Other DBs
NCBI-GeneID: 100367442
NCBI-ProteinID: XP_002740295
Position
Un
AA seq 277 aa AA seqDB search
MQTGYISIPNAGNLPDNSTPSALCLILHGVGEHCERYDTVAAPLTGSGIMVFAHDHVGHG
QSEGIRVDIKDFNIYVRDTIQHVDRITEHYPNLPVFLIGHSMGGTVAILAAMERPDQFTG
MVLVAPAVVENPETATTCKVFMARILAYLAPQFEIGKIEPKYISRDPKEVERYATDPLVW
HRGMKARWSVQTLEALKQLQENMSEIKVPFLVMQGDKDVLVESVGATLLMERAQSKDKQA
QIYPGYYHALQFEPPQDAAIVLRDLTSWIVTRMKQAP
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcagacgggttacatatctataccaaatgctggcaacctacctgataactccacgcca
agtgccttatgtttaatcctgcatggagttggtgaacattgtgaacgatatgacactgta
gccgcaccgctcactggcagtggcattatggtctttgcccatgatcacgttggccatggt
caaagtgaaggtatccgtgtagatataaaagattttaatatttacgtgagagacacgata
caacatgtggacagaataacagagcattatccaaatctaccagtcttcctcattggacat
tccatgggtggtacagttgcaatcctggctgcaatggaaaggccggatcagtttacgggt
atggttcttgtagcgcctgctgtagtggaaaatccagaaacagccacaacatgtaaggtg
tttatggccaggatattggcgtatttagccccacaatttgaaattggaaaaattgaacca
aaatatattagtagggacccgaaagaggtggagcgttatgcaacggatcctcttgtttgg
cataggggaatgaaagccaggtggtcagtacagactttagaagccttgaaacaactccag
gagaatatgtccgagattaaggtgccattcttggtgatgcagggagataaagacgtcctc
gtagaaagtgtaggtgcaacattactgatggaaagggcccagagcaaggataaacaagcg
cagatttatcctgggtactatcatgctctacaatttgaaccaccgcaagatgcggcaatt
gtgctgcgagacctgacgtcttggattgtgacaaggatgaaacaggctccatag

DBGET integrated database retrieval system