KEGG   Saccoglossus kowalevskii (acorn worm): 100368679Help
Entry
100368679         CDS       T04123                                 

Definition
(RefSeq) cathepsin O-like
  KO
K01374  cathepsin O [EC:3.4.22.42]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
sko04142  Lysosome
Brite
KEGG Orthology (KO) [BR:sko00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100368679
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sko01002]
    100368679
Enzymes [BR:sko01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.42  cathepsin O
     100368679
Peptidases [BR:sko01002]
 Cysteine Peptidases
  Family C1: papain family
   100368679
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Inhibitor_I29
Motif
Other DBs
NCBI-GeneID: 100368679
NCBI-ProteinID: XP_002736191
Position
Un
AA seq 367 aa AA seqDB search
MVDIVCRSIRLTCTYCVVLVLCYLPCAIQYDVQPGNIDEDVQFKEFILKHRKPYIAGTTE
YEHRFRVFQQSLHRIRKRISLSRQLNDTAVYGITQFSDLTPDEFQQMYLTLRPSKSSQIP
VSLVQFPSAFNSSNVPPDMPKKYDLRDKSAVSAVKDQGSCGGCWSFSTVQGMETKWVLNG
GKMTELSVQQLIDCDTSSSGCAGGDTCIAMAWLKTKNVGLITSHNYPFTGHTGECRIKNY
TEGVHLKDFTCKEYIGKEDKMVENLYYNGSLVVALNARSWQDYLGGIIQHHCSAGFNNHA
VQIVGCNKHKSSSSDMFHLFPVGPVPYYVVRNTWGLKFGLQGYLNIKIGDNVCGIASRVS
TVETVKT
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggtggacatcgtctgtagaagtattcgcctcacttgtacttactgtgttgtgcttgtt
ctttgctacctaccgtgtgctattcagtacgacgtccaacctgggaatatcgacgaagat
gtgcaatttaaagaattcatcttaaaacacagaaagccgtatatcgctggcacaacggaa
tacgaacatcgcttccgggttttccagcaaagcttacacagaatccgtaagcgtatttct
ctgtcaagacaacttaacgacacagcagtttatggaattacgcaattttcggatctcaca
cctgatgaatttcaacaaatgtatctaaccttaaggccatcaaaatcatcgcagattcct
gtatcattggtccaatttccaagtgcatttaacagctcgaatgtgcctcctgatatgcct
aagaagtatgatttgagagataagagtgcagtgagtgcagtcaaagaccaaggctcgtgt
ggtggctgttggtctttcagtacagtgcaaggaatggaaactaagtgggtactaaatggt
ggtaaaatgactgagttgagcgtgcaacaactgattgactgtgatacatccagtagtggg
tgtgctggtggtgatacatgcatcgctatggcttggctaaaaaccaaaaatgttggactg
atcacatcccataattacccattcacaggacacactggtgaatgtagaataaaaaattac
actgaaggtgttcacttgaaggacttcacctgtaaggagtatattggtaaagaagataag
atggtggaaaacctgtactacaatggctctttggttgtagcattgaatgctcgcagttgg
caagattacttgggtggcatcatacagcatcattgttcagctggattcaataaccatgca
gtgcagatagtgggatgcaataaacataaatcttcgtctagtgatatgtttcatctattt
cctgtaggaccagttccttattacgtggtcagaaatacttggggtcttaaattcggactg
caaggttatttaaatatcaaaataggtgataacgtctgtggaattgctagcagagtttca
actgtggaaacagtgaagacatga

DBGET integrated database retrieval system